DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and CG9222

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:206 Identity:67/206 - (32%)
Similarity:115/206 - (55%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPD--AANSVRKEVCIQKMLQDKHILRF 83
            |..|.:.:|.|.|.:||:..:.:.|:.||:|::...|.|.  ....:.:|:...|.|..::::.|
  Fly    75 GIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITF 139

  Fly    84 FGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPEN 148
            :.........|:.::.|..|.|.|.:.....:.:.:::..|.||:|.:.|:|.:|:.|||:|.||
  Fly   140 YQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCEN 204

  Fly   149 LLLDEHDNVKISDFGMATM-FRCKGKERLLDKR-CGTLPYVAPEVLQ-KAYHAQPADLWSCGVIL 210
            |||||:.|:|:.|||.|.. .|....:.:|.|. ||:..|.:||:|: .||....:|:|:|||:.
  Fly   205 LLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVC 269

  Fly   211 VTMLAGELPWD 221
            ..|:.|.||:|
  Fly   270 YAMVFGRLPYD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 67/206 (33%)
S_TKc 22..278 CDD:214567 66/205 (32%)
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 67/206 (33%)
S_TKc 78..332 CDD:214567 66/203 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.