DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and ppk8

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_593057.1 Gene:ppk8 / 2541663 PomBaseID:SPAC22G7.08 Length:513 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:79/272 - (29%)
Similarity:112/272 - (41%) Gaps:76/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDAANSVRKEVCIQKMLQ---DKHILRFFG 85
            |...:||||...::::.:|             .|.|         :.:.|:.:   |..:||.: 
pombe   243 LNNVIGEGASSFIRVINDR-------------NKLP---------IYVAKVFRPPLDTSLLRRY- 284

  Fly    86 KRSQGSVEYIFLEYAAGGELFDRIEP------DVGMPQH-------------------------E 119
                  |.|...||.....|   ..|      |:...:|                         :
pombe   285 ------VRYFIAEYTFASTL---RHPNIIKVLDIIYKRHTILQIIEYVPYDLFTFITKGHCSALK 340

  Fly   120 AQRYFTQLLSGLNYLHQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLL--DKRCG 182
            |.:.|.|||.|:.|:|..||||||:|.:|::|||:.||||.|||.|.:|....:...|  |...|
pombe   341 ADQMFFQLLDGVAYMHSLGIAHRDIKLDNIMLDENLNVKIIDFGTAFVFHYPFESTTLMSDGVVG 405

  Fly   183 TLPYVAPEVL-QKAYHAQPADLWSCGVILVTMLAGELPWDQPSTNCTEF----TNWRD-NDHWQL 241
            :.|||||||| ||.|.....|:|||.::...:.....||..|.|:...|    |...| |...||
pombe   406 SKPYVAPEVLTQKPYDPSAVDVWSCAIVYCCIALKRFPWKVPHTSDKRFNLYVTQRNDPNTKSQL 470

  Fly   242 --QTPWSKLDTL 251
              ..|.:..||:
pombe   471 IESLPMNSRDTI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 79/272 (29%)
S_TKc 22..278 CDD:214567 79/272 (29%)
ppk8NP_593057.1 S_TKc 242..505 CDD:214567 79/272 (29%)
STKc_HAL4_like 247..505 CDD:270896 78/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.