DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grp and oca2

DIOPT Version :9

Sequence 1:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_587949.1 Gene:oca2 / 2539239 PomBaseID:SPCC1020.10 Length:650 Species:Schizosaccharomyces pombe


Alignment Length:312 Identity:81/312 - (25%)
Similarity:122/312 - (39%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDA----ANSVRKEVCIQKMLQDKHILRFFGKRS 88
            ||.||.|.|:::.....|:..|:|....::..:.    |..|..|.||...|...:|:.......
pombe   308 LGSGAGGSVRIMKRSSDGKIFAVKEFRARRPTETEREYARKVTAEFCIGSALHHTNIIETLDIVE 372

  Fly    89 QGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENLLLDE 153
            :....|..:|||........:...:.||  |....|.|||||:.|||..|:||||||.:||::|.
pombe   373 ENKKFYEVMEYAPYDMFSIVMSGKMTMP--EVYCCFKQLLSGVAYLHSMGLAHRDLKLDNLVVDS 435

  Fly   154 HDNVKISDFGMATMFRCKGKERLLDKR--CGTLPYVAPEVL-QKAYHAQPADLWSCGVILVTMLA 215
            :..|||.|||.|.:|:...:..:::..  .|:.||:|||.| :|.|..:..|:||..:|...|..
pombe   436 NCFVKIIDFGSAVVFKYPFEADIVEATGVVGSDPYLAPETLVRKLYDPRAVDIWSSAIIFCCMAL 500

  Fly   216 GELPWDQPSTNCTEFTNW----------------------------------RDNDH-------- 238
            ...||..|..:...|..:                                  .|..|        
pombe   501 RRFPWKYPKLSDNSFRLFCMKQPSNDAESPSDILADIKKQRLVEQGCEPIRKTDESHSPNSKTDN 565

  Fly   239 -----WQLQTPWSKL-----DTLAISLLRKLLATSPGTRLTLEKTLDHKWCN 280
                 .:|..||..|     :|.|:  :..:|...|..|..:.:.....|.|
pombe   566 SSTHKQELYGPWRLLRLLPRETRAV--IAHMLELDPVKRYDIHRVFADNWIN 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 79/309 (26%)
S_TKc 22..278 CDD:214567 79/308 (26%)
oca2NP_587949.1 S_TKc 303..614 CDD:214567 79/309 (26%)
PKc_like 308..614 CDD:304357 79/309 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.