DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her and REST

DIOPT Version :9

Sequence 1:NP_001260506.1 Gene:her / 34992 FlyBaseID:FBgn0001185 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001180437.1 Gene:REST / 5978 HGNCID:9966 Length:1097 Species:Homo sapiens


Alignment Length:405 Identity:82/405 - (20%)
Similarity:149/405 - (36%) Gaps:120/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FRCSVDRCPYRTNRPYNLARHEESHIGITQSKLYGCPVCVYNTDKASNLKRHVSIKHPGCKKRPP 85
            ::|.:  |||.:::..:|.||..:|.|   .|.:.|..|.|.......:.||....|.|.|  |.
Human   304 YKCEL--CPYSSSQKTHLTRHMRTHSG---EKPFKCDQCSYVASNQHEVTRHARQVHNGPK--PL 361

  Fly    86 EAQHKDRNAKLQCLVMGCRYETNRPYDLKRHLMVHNNPEKSHRTFKCSLCTYSSDRKANLKRHHE 150
            ...|             |.|:|....:.|:|:.:|.||    |.|.|.:|.|::.:|.||:.|.:
Human   362 NCPH-------------CDYKTADRSNFKKHVELHVNP----RQFNCPVCDYAASKKCNLQYHFK 409

  Fly   151 LRHSGIEEAIQTAEELRQEMLLEKQMLKEHKLKYQIT-EKQDLKNLKLKDQKQKVQMLRDQQPKQ 214
            .:|...........:::    |:|...:|..|...|| ||.:::..|:|.         |...|:
Human   410 SKHPTCPNKTMDVSKVK----LKKTKKREADLPDNITNEKTEIEQTKIKG---------DVAGKK 461

  Fly   215 RQK-----KEQLLEDQSPVLNKQLEHGNIPLKEALVGSMKYDEESLEFVYEELQEEEQPPIITIS 274
            .:|     |..:.:::.|       ..|:.:.:....:.|           .:.|.::..:.|.|
Human   462 NEKSVKAEKRDVSKEKKP-------SNNVSVIQVTTRTRK-----------SVTEVKEMDVHTGS 508

  Fly   275 NPQ-----------------ILHGDIRDKHVIAVNVDGQLRWFQSIDPPPGAPTKLELPIKSTSI 322
            |.:                 .|||.:.|:.                     :.||.:..::|.|.
Human   509 NSEKFSKTKKSKRKLEVDSHSLHGPVNDEE---------------------SSTKKKKKVESKSK 552

  Fly   323 SVQQQMDELDDELAMSLAEEDQQDEFLVPMLSGEEPVKIKQSSLTDLAWSWSTPDAVHHISPKAE 387
            :..|::.:.|     |..||:::....:...:.::.:|.|.|..                |.|..
Human   553 NNSQEVPKGD-----SKVEENKKQNTCMKKSTKKKTLKNKSSKK----------------SSKPP 596

  Fly   388 LKKDLKAGDADTDFP 402
            .|:.::.|.|..|.|
Human   597 QKEPVEKGSAQMDPP 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
herNP_001260506.1 C2H2 Zn finger 23..45 CDD:275368 7/21 (33%)
C2H2 Zn finger 56..77 CDD:275368 5/20 (25%)
C2H2 Zn finger 98..120 CDD:275368 5/21 (24%)
C2H2 Zn finger 132..149 CDD:275370 6/16 (38%)
tolA 140..>220 CDD:236545 19/85 (22%)
RESTNP_001180437.1 Interaction with SIN3A. /evidence=ECO:0000269|PubMed:10734093 32..122
Interaction with SIN3B. /evidence=ECO:0000269|PubMed:16288918 43..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..103
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..159
Interaction with ZFP90. /evidence=ECO:0000269|PubMed:21284946 145..418 38/137 (28%)
Required for binding to the neuron-restrictive silencer element. /evidence=ECO:0000250|UniProtKB:Q8VIG1 201..212
C2H2 Zn finger 250..270 CDD:275368
C2H2 Zn finger 278..298 CDD:275368
COG5048 302..>381 CDD:227381 25/96 (26%)
C2H2 Zn finger 306..326 CDD:275368 7/21 (33%)
zf-H2C2_2 318..343 CDD:316026 9/27 (33%)
C2H2 Zn finger 334..355 CDD:275368 5/20 (25%)
C2H2 Zn finger 363..383 CDD:275368 6/32 (19%)
C2H2 Zn finger 391..407 CDD:275368 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..642 36/229 (16%)
FtsK <599..>767 CDD:332908 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 774..837
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 853..938
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 961..1049
Interaction with RCOR1. /evidence=ECO:0000269|PubMed:10449787 1009..1087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7055
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.