DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment her and Zfp513

DIOPT Version :9

Sequence 1:	NP_001260506.1	Gene:	her / 34992	FlyBaseID:	FBgn0001185	Length:	487	Species:	Drosophila melanogaster
Sequence 2:	NP_001012110.1	Gene:	Zfp513 / 313913	RGDID:	1310456	Length:	541	Species:	Rattus norvegicus

Alignment Length:	136	Identity:	47/136 - (34%)
Similarity:	65/136 - (47%)	Gaps:	26/136 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 FRCSVDRCPYRTNRPYNLARHEESHIGITQSKLYGCPVCVYNTDKASNLKRHVSIKHPGCKKRPP 85
            |||:  ||||.:....||.||:..|.|   .|.|.||:|.|.....:|||||..| |.|.|
  Rat   388 FRCA--RCPYASAHLDNLKRHQRVHTG---EKPYKCPLCPYACGNLANLKRHGRI-HSGDK---- 442

  Fly    86 EAQHKDRNAKLQCLVMGCRYETNRPYDLKRHLMVHNNPEKSHRTFKCSLCTYSSDRKANLKRHHE 150
                     ..:|.:  |.|..|:..:||||::.|.    ..:.|:|:.|.|::....|.|||.:
  Rat   443 ---------PFRCSL--CNYSCNQSMNLKRHMLRHT----GEKPFRCATCAYTTGHWDNYKRHQK 492

  Fly   151 LR-HSG 155
            :. |.|
  Rat   493 VHGHGG 498

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
her	NP_001260506.1	C2H2 Zn finger	23..45	CDD:275368	9/21 (43%)
		C2H2 Zn finger	56..77	CDD:275368	10/20 (50%)
		C2H2 Zn finger	98..120	CDD:275368	8/21 (38%)
		C2H2 Zn finger	132..149	CDD:275370	6/16 (38%)
		tolA	140..>220	CDD:236545	6/17 (35%)
Zfp513	NP_001012110.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..120
		C2H2 Zn finger	152..172	CDD:275368
		zf-H2C2_2	164..189	CDD:290200
		COG5048	176..>228	CDD:227381
		C2H2 Zn finger	180..200	CDD:275368
		zf-H2C2_2	192..217	CDD:290200
		C2H2 Zn finger	208..228	CDD:275368
		C2H2 Zn finger	362..382	CDD:275368
		COG5048	<372..>450	CDD:227381	29/82 (35%)
		zf-H2C2_2	374..399	CDD:290200	7/12 (58%)
		C2H2 Zn finger	390..410	CDD:275368	9/21 (43%)
		zf-H2C2_2	402..425	CDD:290200	12/25 (48%)
		COG5048	414..>487	CDD:227381	28/92 (30%)
		C2H2 Zn finger	418..438	CDD:275368	10/20 (50%)
		C2H2 Zn finger	446..466	CDD:275368	8/21 (38%)
		zf-H2C2_2	458..481	CDD:290200	9/26 (35%)
		C2H2 Zn finger	474..493	CDD:275368	7/18 (39%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	492..541		2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	1	0.960