DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trpgamma and zgc:110224

DIOPT Version :9

Sequence 1:NP_001137830.2 Gene:Trpgamma / 34991 FlyBaseID:FBgn0032593 Length:1188 Species:Drosophila melanogaster
Sequence 2:NP_001017642.1 Gene:zgc:110224 / 550335 ZFINID:ZDB-GENE-050417-120 Length:403 Species:Danio rerio


Alignment Length:399 Identity:78/399 - (19%)
Similarity:130/399 - (32%) Gaps:125/399 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSPARRKSVLAPILNKIKNG----ADAADSAEKKLGSESSGSGHIAVQIEPARRVKRHSIHGMME 64
            ::|.:.|.:::......:||    .|.:||:...|.|....:|.:.|:::    :::.|..|.::
Zfish     1 MAPVKIKHIVSFTSQDSRNGVCNLCDGSDSSRPWLCSVQDRTGVLRVELQ----MEKVSAIGFID 61

  Fly    65 EENTIRPHQEI---RQLTLEEKKFLLAV-----------ERGDMAGTRRMLQKA--------QDT 107
            ..|......::   |.....:..|:..:           ::|......||.:||        :..
Zfish    62 VGNYGSAFIQVDVGRSSWSSDHPFVTLLPTATLMSPADSKQGTGRQNVRMFKKADFLSRAAEESW 126

  Fly   108 EYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTF 172
            :.:.|.|..|..:.. ...:....:..||      .||:|:     ||:..:..|.|...|.::.
Zfish   127 DRMRVTCTQPFNKHT-QFGLSFLRIRTVE------DDTEDS-----SEQQEDTPENLRTPEKMSS 179

  Fly   173 HSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQ 237
            ..|    |.|:....:||...||                                |.......|.
Zfish   180 VME----WLSSPAVQNTFFGRIT--------------------------------GDGSSEAQRN 208

  Fly   238 EDSLRHSRSRINA----YRALA-SPSLIALS--------SKDPILTAFELSWELRRLSFLEHEFK 289
            ..||..:...:.|    .|:|: ||...|.|        ||.| ...|..|.||.:..       
Zfish   209 AGSLSRAERMVKAAQLKRRSLSTSPCSTASSTTPQREDNSKSP-PGGFTTSGELVKTP------- 265

  Fly   290 NEYQELRKQCQDFATALLDHTRTSHELEILLNHD-------PTGPVYEHGERMHLNRLKLAIKLR 347
               ||.|              |.....:||||.|       |||..::|.....|.|.:  .:.|
Zfish   266 ---QEQR--------------RKPKARQILLNSDTPLKRSRPTGSTHDHPTSPKLPRSQ--AEAR 311

  Fly   348 QKKFVAHSN 356
            ||...|..:
Zfish   312 QKPIDAQDS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpgammaNP_001137830.2 trp 77..841 CDD:273311 63/319 (20%)
ANK 113..>217 CDD:238125 19/103 (18%)
ANK repeat 118..147 CDD:293786 4/28 (14%)
ANK repeat 175..217 CDD:293786 7/41 (17%)
TRP_2 227..286 CDD:285535 18/71 (25%)
RRT14 <778..892 CDD:293680
zgc:110224NP_001017642.1 XRCC1_N 1..149 CDD:280080 24/152 (16%)
zf-C2HC_2 369..391 CDD:290624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.