DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4631 and CG2898

DIOPT Version :9

Sequence 1:NP_609799.1 Gene:CG4631 / 34988 FlyBaseID:FBgn0032590 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_572623.1 Gene:CG2898 / 31966 FlyBaseID:FBgn0030195 Length:351 Species:Drosophila melanogaster


Alignment Length:121 Identity:32/121 - (26%)
Similarity:48/121 - (39%) Gaps:19/121 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPMAC-LPQFP-RLQRVQSCRPFLEGRKAASCCVSGERR----WGQRNGCMIQVLAKMVNKSSST 72
            ||.|| :|..| ....|..|.|   ..|...||.:..:.    ..|||..:::..:.:...|.  
  Fly    18 NPPACRVPLEPLHPSTVYHCCP---STKCTLCCNNESKHECHCTCQRNKHIVEAFSCLFRVSK-- 77

  Fly    73 VCQFLHQLTLQVF--ARIL--YPLMLGWNTL---KVPFVIPDICELYYGIFDECGN 121
             .|.|..|.|..:  :|.|  :|....|:.:   |.|:.......:|..:||.|||
  Fly    78 -FQILTTLFLLAYHESRPLPRFPRDRNWSVMENVKAPYSELHDLRIYDSLFDRCGN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4631NP_609799.1 DUF4778 46..>241 CDD:292627 20/87 (23%)
CG2898NP_572623.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.