DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtgo and obsl1a

DIOPT Version :10

Sequence 1:NP_001137829.1 Gene:mtgo / 34987 FlyBaseID:FBgn0259735 Length:2064 Species:Drosophila melanogaster
Sequence 2:XP_005166286.1 Gene:obsl1a / 796577 ZFINID:ZDB-GENE-060503-649 Length:2185 Species:Danio rerio


Alignment Length:931 Identity:173/931 - (18%)
Similarity:279/931 - (29%) Gaps:319/931 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 QQQQQQPPQ--QPQQQAPQGPPPPQQQQQQ-QQQV-----------APPAVQGAPSTGSVGAAQG 750
            |:||.||.|  .|||...|..||.|..:.: ||||           :.|.....|.:..|...:.
Zfish   102 QEQQTQPAQAPPPQQNDVQVIPPEQDMKMKIQQQVGVEKKKDPFQDSKPYFLIKPLSLRVDRGED 166

  Fly   751 A-----------PATATATHTHAHSHSHSHAHSHTHPQP------HAHSPHSPSPPNYRDERSQR 798
            |           |...........:..:..||.|...|.      ......:|....|.. ::..
Zfish   167 AAFSCKITGDPLPQVVWEKDGKQLNEIYESAHYHVGQQDGGWFQLKIFKTRTPDGGVYMC-KAVN 230

  Fly   799 QHNKLLRKLEKQRESNPPHSPSPRRANELNGHNNNNIPPGVPLPGHLNNHHHAVNHQGRRLPQQH 863
            :|.:.:.......|..|.|    |..:..||:.|          ||.:..|....|.  :.|..:
Zfish   231 KHGEAITGAVLLVEPIPEH----REGSMTNGYTN----------GHYSPQHSRAKHS--KEPHLN 279

  Fly   864 QGQAHQVAQQQQSQA-----------------RNGNPQHPQR----------------------- 888
            ..:|.:....:...|                 |||....|.|                       
Zfish   280 VSKAKKFTVTEGKHAKFRCYVTGKPKPEIVWKRNGEIIMPSRRHLIFEDREGYYTLKVLYCKQQD 344

  Fly   889 -------AGSSVGGA-SSVGTSEDGED-NSSLAGDDEEEYHRENSIIEQISAIEKPEVIDVTSRA 944
                   |.:::|.. |:|..|..|.. ....|..|.|...|:.:::|    .|.||      .:
Zfish   345 TGLYICAASNALGNTLSAVQLSVKGPPVRFKRALQDSEFRERDVAVLE----CEVPE------ES 399

  Fly   945 AKIIW--ESPAIANTVTVDM------RQLRYQ--------VLLC---DSGKQ------------- 977
            ....|  |...:.:....:|      |:|..|        |.||   |.||.             
Zfish   400 ISTAWYLEDQRLQHGNKYNMEQKGTWRRLTIQNVGADDDGVYLCEMPDGGKTIAELAVKGTIVKK 464

  Fly   978 --------------------------CKYK-SLYQGEAYECIVQDLQPGQDY-LVRLQVHYQKLT 1014
                                      |.:| .|...|.::.|::..  |:.: ||.:...||. :
Zfish   465 LPRRLEVMEGENAAFFVEVEQDDMDICWFKDGLQLQETHQTIIKSF--GKTHILVFVNTSYQD-S 526

  Fly  1015 GTV---------SDPTEFRTP-PCEPDQPPPPKL-VSRTKNSINLRWAAPAANGASIQH------ 1062
            ||:         |.....:|. .|.|..|...:: ....:|.:.|.| :|:.|   :|:      
Zfish   527 GTITFMAGRSTTSSKLRVKTARHCPPICPVGVQMNTDCCQNGVVLSW-SPSPN---LQNSTTKSV 587

  Fly  1063 YLLEYDEGRMPGQPQKFVELAKIKAKHYVIGKLQPTT-VYSFRLAAVNEAGQSPYSPVASYSTSG 1126
            |:||..|  :..|..:.....:......|:|...|.. .:.||:..||:.|:|.:   ..:....
Zfish   588 YVLERQE--VGSQEWQRCLTTETGTSAEVLGDSVPCEGDFRFRICCVNKYGRSGH---VEFPKVV 647

  Fly  1127 NPPPVPKPPQLLASSSSSLKLGWERRAQDGDFLLQLQDAETGHGFLNT----------------- 1174
            :..|.||       ..|.||.......:|..|.::|.....|..|||:                 
Zfish   648 HLAPGPK-------IKSPLKNAVVTEGEDAVFSIELSSELIGTWFLNSQQLQQSEHFSMTQSKNQ 705

  Fly  1175 -----------YKGTELQTECLQLRRASSYQFRLRSENEAGFSPWSP-----------------E 1211
                       |.|.|:......:|.::|.|.::   .|..|.|.|.                 |
Zfish   706 HILRIRQVPNVYDGAEITFIATGVRDSASLQIKV---CEVKFLPLSEMDTKKSTELGNPIVLYCE 767

  Fly  1212 VSYRTLAERPGRPGKP-HAKGKIHGTQFKARWDAPSDSGGAEILCYHLELSAAGPAFERIYSGAE 1275
            ||..|...:..:.||. ||:..:         :..||.....|:.:..|.|.:|     :|:   
Zfish   768 VSQPTATVQWFKDGKELHAEDGL---------NIQSDGNMRRIIIHSAEYSHSG-----VYT--- 815

  Fly  1276 TEAMCERLQPGTTYALRACCEGPAGQSPYSDIGHVTTEAVPPSAPPPPHCSDPPSPYAALLK-LR 1339
                               |:..         ..:.|..|...|||            .|.| ::
Zfish   816 -------------------CQSN---------NDILTFNVNVEAPP------------VLFKEIK 840

  Fly  1340 PPEYNGGAPILEFEAQMRRLEQVQPPQLVYRGKQTYFVAQDLT---PGGMYETQVRAINRIGAGS 1401
            ..|....|..|:.......:.|.:.|...::.....|.:.::|   .|.|....:|:...:.||:
Zfish   841 AEERQKSAMELDPVVLTCEISQPEAPSCWFKDGVAVFQSDNITIQSEGNMRRLIIRSAELVDAGT 905

  Fly  1402 WS-----QWMRFTAAAAAPGV 1417
            ::     |.|.|:.....|.:
Zfish   906 YTCQAGDQTMSFSVNIKEPPI 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtgoNP_001137829.1 FN3 <937..>1125 CDD:442628 49/265 (18%)
FN3 1037..1124 CDD:238020 20/94 (21%)
FN3 <1149..1216 CDD:238020 20/111 (18%)
FN3 1221..1312 CDD:238020 12/91 (13%)
FN3 1334..1409 CDD:238020 16/83 (19%)
FN3 <1380..>1609 CDD:442628 10/46 (22%)
FN3 1619..1714 CDD:238020
obsl1aXP_005166286.1 I-set 8..97 CDD:400151
Ig strand B 25..29 CDD:409390
Ig strand C 38..43 CDD:409390
Ig strand E 63..67 CDD:409390
Ig strand F 77..82 CDD:409390
Ig strand G 90..93 CDD:409390
I-set 150..243 CDD:400151 12/93 (13%)
Ig strand B 167..171 CDD:409405 1/3 (33%)
Ig strand C 180..184 CDD:409405 0/3 (0%)
Ig strand E 209..213 CDD:409405 0/3 (0%)
Ig strand F 223..228 CDD:409405 1/5 (20%)
Ig strand G 236..239 CDD:409405 0/2 (0%)
I-set 284..367 CDD:400151 10/82 (12%)
Ig strand B 294..298 CDD:409405 1/3 (33%)
Ig strand C 307..311 CDD:409405 0/3 (0%)
Ig strand E 333..337 CDD:409405 0/3 (0%)
Ig strand F 347..352 CDD:409405 0/4 (0%)
Ig strand G 360..363 CDD:409405 1/2 (50%)
Ig 373..443 CDD:472250 15/79 (19%)
Ig strand B 389..393 CDD:409559 1/7 (14%)
Ig strand C 401..405 CDD:409559 0/3 (0%)
Ig strand E 426..430 CDD:409559 2/3 (67%)
Ig strand F 440..445 CDD:409559 3/4 (75%)
Ig strand G 450..453 CDD:409559 1/2 (50%)
Ig 464..544 CDD:472250 13/82 (16%)
Ig strand B 477..481 CDD:409559 0/3 (0%)
Ig strand C 489..493 CDD:409559 1/3 (33%)
Ig strand E 514..518 CDD:409559 1/3 (33%)
Ig strand F 528..533 CDD:409559 1/4 (25%)
Ig strand G 537..540 CDD:409559 0/2 (0%)
FN3 567..638 CDD:238020 19/76 (25%)
Ig 653..739 CDD:472250 18/92 (20%)
Ig_3 757..820 CDD:464046 16/107 (15%)
Ig 856..921 CDD:472250 12/64 (19%)
Ig strand C 866..870 CDD:409559 1/3 (33%)
Ig strand E 891..895 CDD:409559 0/3 (0%)
Ig strand F 905..910 CDD:409559 0/4 (0%)
Ig strand G 914..917 CDD:409559 1/2 (50%)
Ig 944..1012 CDD:472250
Ig strand B 945..949 CDD:409559
Ig strand C 957..961 CDD:409559
Ig strand E 982..986 CDD:409559
Ig strand F 996..1001 CDD:409559
Ig strand G 1005..1008 CDD:409559
Ig 1022..1104 CDD:472250
Ig strand B 1037..1041 CDD:409559
Ig strand C 1049..1053 CDD:409559
Ig strand E 1074..1078 CDD:409559
Ig strand F 1088..1093 CDD:409559
Ig strand G 1097..1100 CDD:409559
Ig 1122..1196 CDD:472250
Ig strand B 1129..1133 CDD:409559
Ig strand C 1141..1145 CDD:409559
Ig strand E 1166..1170 CDD:409559
Ig strand F 1180..1185 CDD:409559
Ig strand G 1189..1192 CDD:409559
Ig 1220..1288 CDD:472250
Ig strand B 1221..1225 CDD:409559
Ig strand C 1233..1237 CDD:409559
Ig strand E 1258..1262 CDD:409559
Ig strand F 1272..1277 CDD:409559
Ig strand G 1281..1284 CDD:409559
Ig 1310..1380 CDD:472250
Ig strand B 1313..1317 CDD:409559
Ig strand C 1325..1329 CDD:409559
Ig strand E 1350..1354 CDD:409559
Ig strand F 1364..1369 CDD:409559
Ig strand G 1373..1376 CDD:409559
Ig 1397..1470 CDD:472250
Ig strand B 1404..1408 CDD:409559
Ig strand C 1416..1420 CDD:409559
Ig strand E 1440..1444 CDD:409559
Ig strand F 1454..1459 CDD:409559
Ig strand G 1463..1466 CDD:409559
Ig 1476..1559 CDD:472250
Ig strand B 1492..1496 CDD:409559
Ig strand C 1504..1508 CDD:409559
Ig strand E 1529..1533 CDD:409559
Ig strand F 1543..1548 CDD:409559
Ig strand G 1552..1555 CDD:409559
Ig 1566..1649 CDD:472250
Ig strand B 1582..1586 CDD:409353
Ig strand C 1595..1598 CDD:409353
Ig strand E 1619..1623 CDD:409353
Ig strand F 1633..1638 CDD:409353
Ig strand G 1651..1654 CDD:409353
Ig 1662..1738 CDD:472250
Ig strand B 1671..1675 CDD:409559
Ig strand C 1683..1687 CDD:409559
Ig strand E 1708..1712 CDD:409559
Ig strand F 1722..1727 CDD:409559
Ig strand G 1731..1734 CDD:409559
IG_like 1751..1827 CDD:214653
Ig 1841..1916 CDD:472250
Ig strand B 1849..1853 CDD:409559
Ig strand C 1861..1865 CDD:409559
Ig strand E 1886..1890 CDD:409559
Ig strand F 1900..1905 CDD:409559
Ig strand G 1909..1912 CDD:409559
Ig 1924..2005 CDD:472250
Ig strand B 1938..1942 CDD:409541
Ig strand C 1951..1954 CDD:409541
Ig strand E 1975..1979 CDD:409541
Ig strand F 1989..1994 CDD:409541
Ig strand G 2002..2006 CDD:409541
Ig 2011..2094 CDD:472250
Ig strand B 2027..2031 CDD:409353
Ig strand C 2039..2043 CDD:409353
Ig strand E 2064..2068 CDD:409353
Ig strand G 2087..2090 CDD:409353
Ig 2101..2184 CDD:472250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.