DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtgo and MYBPHL

DIOPT Version :10

Sequence 1:NP_001137829.1 Gene:mtgo / 34987 FlyBaseID:FBgn0259735 Length:2064 Species:Drosophila melanogaster
Sequence 2:NP_001010985.2 Gene:MYBPHL / 343263 HGNCID:30434 Length:354 Species:Homo sapiens


Alignment Length:331 Identity:70/331 - (21%)
Similarity:102/331 - (30%) Gaps:123/331 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 NKLLRKLEKQRESNPPH--------SPSPRRANELNGHNNNNIPPGVPLPGHLNNHH-----HAV 852
            :||..|.....::.||.        ||:|:....:..|      |.:.||..|...:     ..|
Human    13 SKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEH------PKIWLPRALRQTYIRKVGDTV 71

  Fly   853 N----HQGRRLPQ---QHQGQAHQVAQQQQSQARNGNP------QHPQRAGS-------SVGGAS 897
            |    .||:..||   .|.|.|   ...::...|||..      :..|||.|       .:||..
Human    72 NLLIPFQGKPKPQAIWTHDGCA---LDTRRVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLE 133

  Fly   898 SVGTSEDGEDNSSLAGDDEEEYHRENSIIEQISAIEKP------EVIDVTSRAAKIIWESPA-IA 955
            :..|.:                         |..||:|      :::||...:|.:.|..|. ..
Human   134 ATATID-------------------------ILVIERPGPPQSIKLVDVWGFSATLEWTPPQDTG 173

  Fly   956 NTVTVDMRQLRYQVLLCDSGKQCKYKSLYQGEAYECIVQDLQPGQDYLVRL-------------- 1006
            ||..     |.|.|...|:.....:..|.......|||.||..|..|..|:              
Human   174 NTAL-----LGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPI 233

  Fly  1007 ---QVHYQKLTGTV-----------SDPTEFRTPP--------------CEPDQPPPPKLVSRTK 1043
               ..|.|| ..||           |:..:|..|.              |.....|.||:: ..|
Human   234 TTDLAHIQK-AATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKII-WLK 296

  Fly  1044 NSINLR 1049
            |.::::
Human   297 NKMDIQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtgoNP_001137829.1 FN3 <937..>1125 CDD:442628 34/156 (22%)
FN3 1037..1124 CDD:238020 3/13 (23%)
FN3 <1149..1216 CDD:238020
FN3 1221..1312 CDD:238020
FN3 1334..1409 CDD:238020
FN3 <1380..>1609 CDD:442628
FN3 1619..1714 CDD:238020
MYBPHLNP_001010985.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 8/33 (24%)
Ig 62..142 CDD:472250 20/107 (19%)
Ig strand B 71..75 CDD:409406 2/3 (67%)
Ig strand C 84..88 CDD:409406 1/3 (33%)
Ig strand E 108..112 CDD:409406 0/3 (0%)
Ig strand F 122..127 CDD:409406 0/4 (0%)
Ig strand G 135..138 CDD:409406 0/2 (0%)
FN3 146..235 CDD:238020 21/93 (23%)
Ig 261..350 CDD:472250 8/43 (19%)
Ig strand B 278..282 CDD:409353 0/3 (0%)
Ig strand C 291..295 CDD:409353 1/4 (25%)
Ig strand E 316..320 CDD:409353
Ig strand F 330..335 CDD:409353
Ig strand G 343..346 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.