DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5953 and CG10904

DIOPT Version :9

Sequence 1:NP_001260503.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:45/99 - (45%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WTNDDALELIEQYRCHTELWNRADPKYKDKLCRFRAWSEIAERFGCSKAEVERKMNVLLTQYRRE 142
            ||.:...:|||.||....|||.....||:|.||.:|...|......:|.:..:|::.|..|:..|
  Fly    24 WTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHDYGKKVHNLRNQFNAE 88

  Fly   143 KHKMFVKIYQGIQPNPS----KWYAFKRFDFMEA 172
            ..|:..::.:......|    :|..||...|:.:
  Fly    89 LKKLERRLEESGGDRDSEKACRWEHFKTLMFLRS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510 25/87 (29%)
CG10904NP_001286800.1 MADF 31..125 CDD:214738 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ4Q
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.