DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5953 and CG15601

DIOPT Version :9

Sequence 1:NP_001260503.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:187 Identity:42/187 - (22%)
Similarity:72/187 - (38%) Gaps:37/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   540 ESRLQLVDMAQDLRVAQAKANFGAFILPPRGSDASTPAMPLNMRKLTGAGSAGHMLMNSLLGSRE 604
            :|.|:.|.::...|  |.|.|..:..|....||.::        ||....:|...:....|...:
  Fly    98 DSFLRSVSLSHCKR--QGKNNSSSAQLTTIKSDETS--------KLLCTAAADITMSEDALEEED 152

  Fly   605 SMSDGEEPDPDNDEATESAA-------------------SPGHIKSSVSAQAAVAASAFYAESLN 650
            :..:||..:...:|:..:|:                   |.|...|...........:.|..||:
  Fly   153 AEVNGEPEECPLEESRPTASICKDDSTLCLADQPQQEHYSQGCSSSQQLPHTMAQRKSKYITSLD 217

  Fly   651 ---RDDCDFIGSNVSLKLRTM-DRTQRIIAEKLISEVLY---YGQFNELE-RSARIQ 699
               .||....|.:::.:|||: |...|.:|:..|.:||:   .|||...| .|.::|
  Fly   218 SAGEDDLIIFGQSIASQLRTIPDSYSRSVAKLRIQQVLFEAETGQFQSTEVNSTQLQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.