DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and CWC23

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_011387.2	Gene:	CWC23 / 852749	SGDID:	S000003096	Length:	283	Species:	Saccharomyces cerevisiae

Alignment Length:	138	Identity:	32/138 - (23%)
Similarity:	51/138 - (36%)	Gaps:	32/138 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   398 SKRKDYYKILGIG-----RNASDD--EIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEA 455
            ::|.:.|.:|.:.     ....||  :||:.||..||.:|||:|.::.:...     ||..:..|
Yeast    11 NQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIH-----KFHLLSTA 70

  Fly   456 YAILSDAHKKSRYDSG-----------------QDIEEQEQADFDPNQMFRTFFQFNGGG---RN 500
            ..||::|..:..||..                 |.:||.|.:............|....|   |.
Yeast    71 TNILTNADVRPHYDRWLIEFLRKTNDIERNKLIQKLEESESSTIPTTTPHPDLLQIQRHGELLRK 135

  Fly   501 NSSFNFEF 508
            ...||..:
Yeast   136 LKHFNLPY 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	29/128 (23%)
		DnaJ	402..469	CDD:278647	20/73 (27%)
CWC23	NP_011387.2	CbpA	14..228	CDD:225124	31/135 (23%)
CWC23	NP_011387.2	DnaJ	15..84	CDD:395170	20/73 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910