DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and TPR12

DIOPT Version :9

Sequence 1:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_177936.1 Gene:TPR12 / 844148 AraportID:AT1G78120 Length:530 Species:Arabidopsis thaliana


Alignment Length:444 Identity:117/444 - (26%)
Similarity:190/444 - (42%) Gaps:63/444 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SDSEREETSS------------NSEMDVEITTEQPTIDVKAEQI------VPKDAATIAEEKKKL 55
            |||.|:..||            |..|...|...||.:.....|.      .|.:.....|..||:
plant   101 SDSARKSISSGSSRTESKRFSLNGVMGNIIVKPQPAVKTDVTQTKSRWEGKPVNHRLDPETLKKM 165

  Fly    56 GNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAY 120
            ||::|....:..||..|..|||..|.:..|:.|::|..:.|.....|......|:|::|.:|:|:
plant   166 GNEEYCRGRFGQALVFYERAISADPKTPTYWSNKSAALISLGRLLEASDACEEALRLNPTYERAH 230

  Fly   121 VRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQT--AAQKLRQLEATIQANYDTKSYRNVV 183
            .|:|...|.||::   |:|:...||....:.....||.  ..:.||:.:...::.....:.:..:
plant   231 QRLASLQLRLGEV---EKALCHYNEAGKYTETKHIEQVEDVVKCLRRCDEARRSKEWNVALKETL 292

  Fly   184 FYLDSALKLAPACLKYRLLKAECLAFLGRCDEA------------LDIAVSVMKLDTTSADAIYV 236
            |.:......:|   :...|:.|.|..|.|.:||            :|..:.:..|..||  .:.:
plant   293 FAISYGADSSP---RVYALQTEALLHLQRHEEAYSVYQKGTKRFDIDSFIKIFGLSLTS--YLLM 352

  Fly   237 RGLCLYYTDNLDKGILHFERALT-------LDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYR 294
            .|..:|.      .:..||.|:|       |||...:...:..|.:.:...:.:||:||.:.::.
plant   353 VGAQVYI------AVGRFEDAVTASRQAARLDPSSEEVNAVARKARAVASARLSGNLLFNASKFE 411

  Fly   295 EAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCY 359
            .|.|:||:.|:.|.:    |:.||.|||....::....:|:.||...|.|...|.||...||..|
plant   412 GASVVYTEGLENDPY----NALLLCNRAASRFKLDLFEKAIEDCTLALSLQPSYRKARRRRADSY 472

  Fly   360 NDLEKFEESVADYETALQLEKTP---EIKRMLREAKFALKKSKRKDYYKILGIG 410
            ..|||::.::.|||  |.:.:||   |.:|.|.|.....||....| .:..|:|
plant   473 AKLEKWQHAIQDYE--LLMMETPEDEETRRALTEVNVRFKKQTGGD-VRFKGVG 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150 20/64 (31%)
TPR repeat 49..77 CDD:276809 10/27 (37%)
TPR repeat 82..112 CDD:276809 6/29 (21%)
TPR_11 201..262 CDD:290150 18/79 (23%)
TPR repeat 201..225 CDD:276809 8/35 (23%)
TPR_1 231..264 CDD:278916 9/39 (23%)
TPR repeat 231..259 CDD:276809 5/27 (19%)
TPR_11 278..345 CDD:290150 20/66 (30%)
TPR repeat 310..344 CDD:276809 10/33 (30%)
TPR_11 314..380 CDD:290150 24/65 (37%)
TPR repeat 349..377 CDD:276809 11/27 (41%)
DnaJ 401..>503 CDD:223560 3/10 (30%)
DnaJ 402..469 CDD:278647 3/9 (33%)
TPR12NP_177936.1 Sec_Non_Glob 43..>140 CDD:275213 11/38 (29%)
TPR_11 158..224 CDD:290150 20/65 (31%)
TPR 159..191 CDD:197478 12/31 (39%)
TPR repeat 159..187 CDD:276809 10/27 (37%)
TPR repeat 192..222 CDD:276809 6/29 (21%)
TPR_11 196..253 CDD:290150 17/59 (29%)
TPR_17 215..247 CDD:290167 11/34 (32%)
TPR repeat 227..253 CDD:276809 10/28 (36%)
TPR_11 302..379 CDD:290150 19/87 (22%)
TPR_11 401..459 CDD:290150 21/61 (34%)
TPR repeat 427..457 CDD:276809 10/29 (34%)
TPR_1 428..461 CDD:278916 10/32 (31%)
TPR_16 434..496 CDD:290168 22/63 (35%)
TPR repeat 462..486 CDD:276809 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D506649at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44200
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.