DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and Dnaja3

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_076135.3	Gene:	Dnaja3 / 83945	MGIID:	1933786	Length:	480	Species:	Mus musculus

Alignment Length:	118	Identity:	43/118 - (36%)
Similarity:	64/118 - (54%)	Gaps:	23/118 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   400 RKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHK 464
            :.|||:|||:.||||..:|||||.:.|..:|||    ::.::.|.:| ||.::.|||.:|||..|
Mouse    91 KDDYYQILGVPRNASQKDIKKAYYQLAKKYHPD----TNKDDPKAKE-KFSQLAEAYEVLSDEVK 150

  Fly   465 KSRYD-------------SGQDIEEQEQADFDPNQMFRTFFQFNGGGRNNSSF 504
            :.:||             |||.. .:.....||.::||..|    |..::|.|
Mouse   151 RKQYDAYGSAGFDPGTSSSGQGY-WRGGPSVDPEELFRKIF----GEFSSSPF 198

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	41/114 (36%)
		DnaJ	402..469	CDD:278647	30/66 (45%)
Dnaja3	NP_076135.3	DnaJ	90..480	CDD:223560	43/118 (36%)
		DnaJ	93..155	CDD:278647	30/66 (45%)
		DnaJ_C	207..416	CDD:199909
		DnaJ_zf	236..296	CDD:199908
		CXXCXGXG motif	236..243
		CXXCXGXG motif	253..260
		CXXCXGXG motif	275..282
		CXXCXGXG motif	289..296
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	437..468
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910