DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and Dnajc21

DIOPT Version :9

Sequence 1:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_084322.2 Gene:Dnajc21 / 78244 MGIID:1925371 Length:531 Species:Mus musculus


Alignment Length:112 Identity:40/112 - (35%)
Similarity:65/112 - (58%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 KDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKK 465
            |.:|:.||:.|:||::|:||||||.||..|||::.:::||..::    ||.:..||.:|||..::
Mouse     2 KCHYEALGVRRDASEEELKKAYRKLALRWHPDKNLDNAAEAAEQ----FKLIQAAYDVLSDPQER 62

  Fly   466 SRYDS--------GQDIEEQEQADFDPNQMFRTFFQFNGGGRNNSSF 504
            :.||:        |.|.|.|:.: .|....| |...::|.|.:...|
Mouse    63 AWYDNHREALLKGGLDGEYQDDS-LDLLHYF-TVTCYSGYGDDERGF 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
TPR_11 201..262 CDD:290150
TPR repeat 201..225 CDD:276809
TPR_1 231..264 CDD:278916
TPR repeat 231..259 CDD:276809
TPR_11 278..345 CDD:290150
TPR repeat 310..344 CDD:276809
TPR_11 314..380 CDD:290150
TPR repeat 349..377 CDD:276809
DnaJ 401..>503 CDD:223560 39/109 (36%)
DnaJ 402..469 CDD:278647 27/66 (41%)
Dnajc21NP_084322.2 DnaJ 3..66 CDD:278647 27/66 (41%)
DBINO <181..243 CDD:290603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..309
zf-C2H2_jaz 314..339 CDD:288983
C2H2 Zn finger 316..338 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.