DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and dnajc3b

DIOPT Version :9

Sequence 1:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571705.1 Gene:dnajc3b / 58154 ZFINID:ZDB-GENE-000831-4 Length:502 Species:Danio rerio


Alignment Length:500 Identity:132/500 - (26%)
Similarity:228/500 - (45%) Gaps:49/500 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IDVKAEQIVPKDAATIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAY--YGNRAACYMM 95
            :|::.:.::......| |...::|.....|.....||..|..|:.  .||.:|  |..||..::.
Zfish    27 LDLQLDGVLGATPVEI-EHHLEMGRKLLAAGQLAEALSHYHSAVE--GDSKSYLTYYKRATVFLA 88

  Fly    96 LLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVK----MVNELNSLSTAVAAE 156
            :....|||.|...||::.|.|..|.::.....|..|   .|::|.:    ::|  :|.....|.:
Zfish    89 MGKSKSALPDLTQAIQLKPDFLAARLQRGNILLKQG---STQEAREDFQAVLN--HSPDHKEAHD 148

  Fly   157 Q-TAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIA 220
            | ..|.||..|:..:...:.....|..|..|:..::|:|...:.|.|:|||...||...:|:   
Zfish   149 QLLKADKLESLQEEVHEAHRRGDCRIAVQVLEHVIELSPWDPESRELRAECYIQLGEPRKAI--- 210

  Fly   221 VSVMKLDTTSAD-------AIYVRGLCLYYT-----DNLDKGILHFERALTLDPDHYKSKQMRSK 273
                 :|.|.|.       |.:::...|:|:     |:|::    ....|.||.|..:...:..:
Zfish   211 -----MDLTPASRLRADNRAAFLKLSQLHYSLGEHHDSLNQ----VRECLKLDQDDKECFALYKQ 266

  Fly   274 CKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADC 338
            .|:|.:..::...|....|::||...|...::.:.:.....:|..........::.:..|||..|
Zfish   267 VKKLSKQLDSAEELISEQRFQEAIEKYESVMRTEPNVAFYTNKAKERTCFCLVKMKSAEEAVDIC 331

  Fly   339 NRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQL-EKTPEIKRMLREAKFALKKSKRKD 402
            :...:...|.:..|..||..|..::::|::|.||:.|.:. ::..|::..|..|...||.|:::|
Zfish   332 SEAHQREPQNIHILRDRAEAYILMQEYEKAVEDYQEAREFDQENQELREGLDRAHKLLKISRKRD 396

  Fly   403 YYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSR 467
            ||||||:.|:|:..||.|||||.|...|||..  .|..::||.|.||.::..|..:|:|...:.:
Zfish   397 YYKILGVSRSANKQEIIKAYRKLAQQWHPDNF--QSEADKKEAEKKFIDIASAKEVLTDPEMRQK 459

  Fly   468 YDSGQD-IEEQEQ---ADFDPNQMFRTFFQFNGGGRNNSSFNFEF 508
            :|||:| ::.:.|   ....|.:....|..|.||   |..|.|.|
Zfish   460 FDSGEDPLDPENQQGGGGGGPREWPFGFNPFEGG---NFHFKFNF 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150 19/66 (29%)
TPR repeat 49..77 CDD:276809 7/27 (26%)
TPR repeat 82..112 CDD:276809 11/31 (35%)
TPR_11 201..262 CDD:290150 17/72 (24%)
TPR repeat 201..225 CDD:276809 7/23 (30%)
TPR_1 231..264 CDD:278916 9/44 (20%)
TPR repeat 231..259 CDD:276809 6/39 (15%)
TPR_11 278..345 CDD:290150 10/66 (15%)
TPR repeat 310..344 CDD:276809 5/33 (15%)
TPR_11 314..380 CDD:290150 15/66 (23%)
TPR repeat 349..377 CDD:276809 9/27 (33%)
DnaJ 401..>503 CDD:223560 40/105 (38%)
DnaJ 402..469 CDD:278647 29/66 (44%)
dnajc3bNP_571705.1 TPR_11 41..107 CDD:290150 20/68 (29%)
TPR repeat 42..70 CDD:276809 8/28 (29%)
TPR repeat 75..105 CDD:276809 10/29 (34%)
TPR_11 77..141 CDD:290150 17/68 (25%)
TPR repeat 110..137 CDD:276809 5/29 (17%)
TPR repeat 157..184 CDD:276809 4/26 (15%)
TPR_11 189..254 CDD:290150 17/76 (22%)
TPR repeat 190..218 CDD:276809 11/35 (31%)
TPR repeat 223..253 CDD:276809 6/33 (18%)
TPR repeat 303..337 CDD:276809 5/33 (15%)
TPR repeat 342..370 CDD:276809 9/27 (33%)
TPR 348..375 CDD:197478 8/26 (31%)
DnaJ 394..>500 CDD:223560 41/110 (37%)
DnaJ 396..461 CDD:278647 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53711
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.