DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and Dnajc4

DIOPT Version :10

Sequence 1:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001343928.1 Gene:Dnajc4 / 57431 MGIID:1927346 Length:261 Species:Mus musculus


Alignment Length:74 Identity:26/74 - (35%)
Similarity:41/74 - (55%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 KKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILS 460
            ::|...:||::||:...||.:|||:|:..|:...||||...:.|...     :|.|:.|||.:||
Mouse    47 QRSVPTNYYELLGVHPGASAEEIKRAFFTKSKELHPDRDPGNPALHS-----RFVELNEAYRVLS 106

  Fly   461 DAHKKSRYD 469
            ....:..||
Mouse   107 REESRRNYD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809
TPR 55..>258 CDD:440225
TPR repeat 82..112 CDD:276809
TPR 190..419 CDD:440225 8/22 (36%)
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090 25/68 (37%)
Dnajc4NP_001343928.1 DnaJ 53..>157 CDD:440252 25/68 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.