DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and Dnaja2

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_062768.1	Gene:	Dnaja2 / 56445	MGIID:	1931882	Length:	412	Species:	Mus musculus

Alignment Length:	97	Identity:	36/97 - (37%)
Similarity:	51/97 - (52%)	Gaps:	13/97 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   404 YKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRY 468
            |.|||:...||::|:||||||.|..:|||::.|:..        ||||:..||.:||:..|:..|
Mouse    10 YDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGD--------KFKEISFAYEVLSNPEKRELY 66

  Fly   469 D--SGQDIEEQEQADFDPNQMFRTFFQFNGGG 498
            |  ..|.:.|........:.:|...|   |||
Mouse    67 DRYGEQGLREGSGGGGGMDDIFSHIF---GGG 95

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	36/97 (37%)
		DnaJ	402..469	CDD:278647	27/64 (42%)
Dnaja2	NP_062768.1	PTZ00037	4..412	CDD:240236	36/97 (37%)
		CXXCXGXG motif	143..150
		CXXCXGXG motif	159..166
		CXXCXGXG motif	186..193
		CXXCXGXG motif	202..209
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	365..412
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000