DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and dnajb2

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_001073462.1	Gene:	dnajb2 / 561686	ZFINID:	ZDB-GENE-061013-537	Length:	389	Species:	Danio rerio

Alignment Length:	116	Identity:	47/116 - (40%)
Similarity:	64/116 - (55%)	Gaps:	25/116 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   402 DYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKS 466
            |||.:||:.|:||.|:|||||||.||..|||:    :.:.::|.|.||||:.|||.:|||..|:.
Zfish     3 DYYDVLGVSRSASPDDIKKAYRKLALQWHPDK----NPDNKEEAEKKFKEIAEAYEVLSDKSKRD 63

  Fly   467 RYD---------SGQDIEEQEQADF--------DPNQMFRTFFQFNGGGRN 500
            .||         ||.........||        .|:::||.||    ||::
Zfish    64 DYDRYGRSDMPSSGSGSSGSFPDDFPGFTFTFRSPDEVFREFF----GGQD 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	47/116 (41%)
		DnaJ	402..469	CDD:278647	34/66 (52%)
dnajb2	NP_001073462.1	DnaJ	2..>108	CDD:223560	45/112 (40%)
		DnaJ	3..66	CDD:278647	34/66 (52%)
		UIM	269..285	CDD:280900
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910