DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and CG3061

DIOPT Version :9

Sequence 1:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:156 Identity:51/156 - (32%)
Similarity:68/156 - (43%) Gaps:48/156 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 SVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPD 432
            |..|| |..|||...::|..             ||||::||:.:.|:|.||||||:|.||..|||
  Fly    86 SAPDY-TKDQLEAVRKVKTC-------------KDYYEVLGVSKTATDSEIKKAYKKLALQLHPD 136

  Fly   433 RHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYD--------------------SGQDIEEQ 477
            ::....|.|      .||.:|.|..:|:||.|:..||                    .||....:
  Fly   137 KNKAPGAVE------AFKALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNE 195

  Fly   478 E------QADFDPNQMFRTFFQFNGG 497
            .      |||....::|..|  ||||
  Fly   196 YGYSRGFQADISAEELFNMF--FNGG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
TPR_11 201..262 CDD:290150
TPR repeat 201..225 CDD:276809
TPR_1 231..264 CDD:278916
TPR repeat 231..259 CDD:276809
TPR_11 278..345 CDD:290150
TPR repeat 310..344 CDD:276809
TPR_11 314..380 CDD:290150 6/11 (55%)
TPR repeat 349..377 CDD:276809 4/8 (50%)
DnaJ 401..>503 CDD:223560 43/123 (35%)
DnaJ 402..469 CDD:278647 29/66 (44%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 43/123 (35%)
DnaJ 106..167 CDD:278647 29/66 (44%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.