DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and CG2790

DIOPT Version :10

Sequence 1:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster


Alignment Length:107 Identity:38/107 - (35%)
Similarity:63/107 - (58%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 YYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSR 467
            ||:.|.:.|||:|.:||.||||.||..|||::.:..||.::    :|:.:.:||.:|||..::|.
  Fly     4 YYEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKE----RFQLIQQAYEVLSDPQERSW 64

  Fly   468 YDSGQD-IEEQEQADFDPN--QMFRTFFQ--FNGGGRNNSSF 504
            ||:.:: |...:.:|:..|  .:|:.|..  :.|.|.|...|
  Fly    65 YDNHREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809
TPR 55..>258 CDD:440225
TPR repeat 82..112 CDD:276809
TPR 190..419 CDD:440225 7/15 (47%)
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090 37/104 (36%)
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 38/107 (36%)
PRK10767 2..>66 CDD:236757 27/65 (42%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.