DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and Dnajc30

DIOPT Version :10

Sequence 1:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001102494.1 Gene:Dnajc30 / 368190 RGDID:1595783 Length:219 Species:Rattus norvegicus


Alignment Length:80 Identity:27/80 - (33%)
Similarity:43/80 - (53%) Gaps:11/80 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 RKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSS-AEERKEEELKFKEVGEAYAILSDAH 463
            |...|.:||:...|:..:||.||.:::.::||||:..|: |.||      |..:.|||.:|....
  Rat    40 RNALYDLLGVPSTATQAQIKAAYYRQSFLYHPDRNPGSTEAAER------FTRISEAYLVLGSTI 98

  Fly   464 KKSRYDSG----QDI 474
            .:.:||.|    ||:
  Rat    99 LRRKYDRGLLSDQDL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809
TPR 55..>258 CDD:440225
TPR repeat 82..112 CDD:276809
TPR 190..419 CDD:440225 5/18 (28%)
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090 26/78 (33%)
Dnajc30NP_001102494.1 DnaJ 43..104 CDD:395170 21/66 (32%)
PRK10266 44..>168 CDD:182347 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.