DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and Dnajc30

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_001102494.1	Gene:	Dnajc30 / 368190	RGDID:	1595783	Length:	219	Species:	Rattus norvegicus

Alignment Length:	80	Identity:	27/80 - (33%)
Similarity:	43/80 - (53%)	Gaps:	11/80 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   400 RKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSS-AEERKEEELKFKEVGEAYAILSDAH 463
            |...|.:||:...|:..:||.||.:::.::||||:..|: |.||      |..:.|||.:|....
  Rat    40 RNALYDLLGVPSTATQAQIKAAYYRQSFLYHPDRNPGSTEAAER------FTRISEAYLVLGSTI 98

  Fly   464 KKSRYDSG----QDI 474
            .:.:||.|    ||:
  Rat    99 LRRKYDRGLLSDQDL 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	26/79 (33%)
		DnaJ	402..469	CDD:278647	21/67 (31%)
Dnajc30	NP_001102494.1	DnaJ	43..104	CDD:278647	21/66 (32%)
Dnajc30	NP_001102494.1	DnaJ	44..>105	CDD:223560	22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166350651
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930