DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and Dnajc24

DIOPT Version :10

Sequence 1:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:77 Identity:27/77 - (35%)
Similarity:47/77 - (61%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 ALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRH-ANSSAEERKEEELKFKEVGEAYA 457
            |.:::.:||:|.|||...:|...::|:.|:|..|::|||:. |:..|...:|...||.|:.:|:.
  Rat     2 AFEQTVKKDWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWK 66

  Fly   458 ILSDAHKKSRYD 469
            ||.:...|.:||
  Rat    67 ILGNEETKKKYD 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809
TPR 55..>258 CDD:440225
TPR repeat 82..112 CDD:276809
TPR 190..419 CDD:440225 8/24 (33%)
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090 25/69 (36%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 23/67 (34%)
zf-CSL 94..147 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.