| Sequence 1: | NP_523584.1 | Gene: | Tpr2 / 34984 | FlyBaseID: | FBgn0032586 | Length: | 508 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001260431.1 | Gene: | DnaJ-H / 34707 | FlyBaseID: | FBgn0032474 | Length: | 440 | Species: | Drosophila melanogaster |
| Alignment Length: | 40 | Identity: | 12/40 - (30%) |
|---|---|---|---|
| Similarity: | 18/40 - (45%) | Gaps: | 5/40 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 47 LRKELPVRLANIMKEITLLPESLLRMPSVGLVSAWYVKSF 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tpr2 | NP_523584.1 | TPR repeat | 49..77 | CDD:276809 | 8/27 (30%) |
| TPR | 55..>258 | CDD:440225 | 7/32 (22%) | ||
| TPR repeat | 82..112 | CDD:276809 | 2/5 (40%) | ||
| TPR | 190..419 | CDD:440225 | |||
| TPR repeat | 201..225 | CDD:276809 | |||
| TPR repeat | 231..259 | CDD:276809 | |||
| TPR repeat | 310..344 | CDD:276809 | |||
| TPR repeat | 349..377 | CDD:276809 | |||
| DnaJ_bact | 402..>503 | CDD:274090 | |||
| DnaJ-H | NP_001260431.1 | PTZ00037 | 1..386 | CDD:240236 | 8/25 (32%) |
| Blue background indicates that the domain is not in the aligned region. | |||||