DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and Dnajb5

DIOPT Version :9

Sequence 1:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:166 Identity:60/166 - (36%)
Similarity:74/166 - (44%) Gaps:45/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 LKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNA 413
            |:.|.|||...|...||..                     :|..........|||||||||...|
  Rat    44 LEPLKLRAWTLNGFVKFRN---------------------KEPSTGPVAVMGKDYYKILGIPSGA 87

  Fly   414 SDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYD--------S 470
            ::|||||||||.||.:|||::...:|||      ||||:.|||.:|||..|:|.||        :
  Rat    88 NEDEIKKAYRKMALKYHPDKNKEPNAEE------KFKEIAEAYDVLSDPKKRSLYDQYGEEGLKT 146

  Fly   471 GQDIEEQEQADF------DPNQMFRTFFQFNGGGRN 500
            |..........|      ||:..|.:||    ||.|
  Rat   147 GGGTSGGSGGSFHYTFHGDPHATFASFF----GGSN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
TPR_11 201..262 CDD:290150
TPR repeat 201..225 CDD:276809
TPR_1 231..264 CDD:278916
TPR repeat 231..259 CDD:276809
TPR_11 278..345 CDD:290150
TPR repeat 310..344 CDD:276809
TPR_11 314..380 CDD:290150 8/30 (27%)
TPR repeat 349..377 CDD:276809 8/27 (30%)
DnaJ 401..>503 CDD:223560 51/114 (45%)
DnaJ 402..469 CDD:278647 38/66 (58%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 51/117 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.