DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and Dnaja4

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_001020582.1	Gene:	Dnaja4 / 300721	RGDID:	1310035	Length:	555	Species:	Rattus norvegicus

Alignment Length:	109	Identity:	46/109 - (42%)
Similarity:	59/109 - (54%)	Gaps:	15/109 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   396 KKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILS 460
            |..|...||.|||:..:||.:||||||||.||.:|||::        .:|..|||.:.:||.:||
  Rat   158 KMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKN--------PDEGEKFKLISQAYEVLS 214

  Fly   461 DAHKKSRYDSG--QDIEEQEQAD---FDPNQMFRTFFQFNGGGR 499
            |..|:..||.|  |.|:|.....   ..|..:|..|  |.||||
  Rat   215 DPKKRDIYDQGGEQAIKEGGSGSPSFSSPMDIFDMF--FGGGGR 256

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	44/104 (42%)
		DnaJ	402..469	CDD:278647	30/66 (45%)
Dnaja4	NP_001020582.1	PTZ00037	144..552	CDD:240236	46/109 (42%)
		DnaJ	165..223	CDD:278647	30/65 (46%)
		DnaJ_C	264..490	CDD:199909
		DnaJ_zf	293..359	CDD:199908
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910