powered by:
Protein Alignment Tpr2 and Dnajc5g
DIOPT Version :9
Sequence 1: | NP_001260501.1 |
Gene: | Tpr2 / 34984 |
FlyBaseID: | FBgn0032586 |
Length: | 508 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011239025.1 |
Gene: | Dnajc5g / 231098 |
MGIID: | 3045263 |
Length: | 177 |
Species: | Mus musculus |
Alignment Length: | 70 |
Identity: | 31/70 - (44%) |
Similarity: | 41/70 - (58%) |
Gaps: | 7/70 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 401 KDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHA-NSSAEERKEEELKFKEVGEAYAILSDAHK 464
|..|.:|.:.:.|...:|||||||.||.:|||::. |..|.| .|||:..|:|||:|..|
Mouse 16 KSLYAVLELKKGAETADIKKAYRKLALQYHPDKNPDNPLAAE------IFKEINTAHAILTDPTK 74
Fly 465 KSRYD 469
|..||
Mouse 75 KKIYD 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167847143 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.