DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tpr2 and dnj-16

DIOPT Version :9

Sequence 1:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster
Sequence 2:	NP_001254890.1	Gene:	dnj-16 / 175540	WormBaseID:	WBGene00001034	Length:	395	Species:	Caenorhabditis elegans

Alignment Length:	105	Identity:	42/105 - (40%)
Similarity:	63/105 - (60%)	Gaps:	15/105 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   397 KSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSS-AEERKEEELKFKEVGEAYAILS 460
            |....|:|::||:.:.||:.|||.||||.||.:||||:.|.: |:|      :||:|..||::||
Worm    29 KVSEMDFYQLLGVEKMASEAEIKSAYRKLALKYHPDRNPNDAHAQE------EFKKVSIAYSVLS 87

  Fly   461 DAHKKSRYD-SGQDIEEQEQADFDPNQMFRTFFQFNGGGR 499
            |.:|:.:|| ||....:.:...||.::|       .|.||
Worm    88 DPNKRRQYDVSGPSENQLDFEGFDVSEM-------GGVGR 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	41/101 (41%)
		DnaJ	402..469	CDD:278647	31/67 (46%)
dnj-16	NP_001254890.1	DnaJ	30..>127	CDD:223560	41/104 (39%)
dnj-16	NP_001254890.1	PLN02281	297..>370	CDD:177920
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910