DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpr2 and Dnajc5

DIOPT Version :10

Sequence 1:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_058055.1 Gene:Dnajc5 / 13002 MGIID:892995 Length:198 Species:Mus musculus


Alignment Length:78 Identity:34/78 - (43%)
Similarity:50/78 - (64%) Gaps:9/78 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 YKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRY 468
            |.:||:.:||:.|:|||:|||.||.:|||::     .:..|...||||:..|:|||:||.|::.|
Mouse    17 YHVLGLDKNATSDDIKKSYRKLALKYHPDKN-----PDNPEAADKFKEINNAHAILTDATKRNIY 76

  Fly   469 DS----GQDIEEQ 477
            |.    |..:.||
Mouse    77 DKYGSLGLYVAEQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809
TPR 55..>258 CDD:440225
TPR repeat 82..112 CDD:276809
TPR 190..419 CDD:440225 6/14 (43%)
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090 34/78 (44%)
Dnajc5NP_058055.1 PRK10767 17..>80 CDD:236757 31/67 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.