Sequence 1: | NP_001260501.1 | Gene: | Tpr2 / 34984 | FlyBaseID: | FBgn0032586 | Length: | 508 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001082977.1 | Gene: | dnajb12b / 100037354 | ZFINID: | ZDB-GENE-070410-128 | Length: | 159 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 53/196 - (27%) |
---|---|---|---|
Similarity: | 79/196 - (40%) | Gaps: | 60/196 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 ERALTL------DPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDI 313
Fly 314 NSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQL 378
Fly 379 EKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDR-HANSSAEER 442
Fly 443 K 443 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tpr2 | NP_001260501.1 | TPR_11 | 49..114 | CDD:290150 | |
TPR repeat | 49..77 | CDD:276809 | |||
TPR repeat | 82..112 | CDD:276809 | |||
TPR_11 | 201..262 | CDD:290150 | 2/12 (17%) | ||
TPR repeat | 201..225 | CDD:276809 | |||
TPR_1 | 231..264 | CDD:278916 | 3/14 (21%) | ||
TPR repeat | 231..259 | CDD:276809 | 2/3 (67%) | ||
TPR_11 | 278..345 | CDD:290150 | 12/66 (18%) | ||
TPR repeat | 310..344 | CDD:276809 | 5/33 (15%) | ||
TPR_11 | 314..380 | CDD:290150 | 10/65 (15%) | ||
TPR repeat | 349..377 | CDD:276809 | 6/27 (22%) | ||
DnaJ | 401..>503 | CDD:223560 | 24/44 (55%) | ||
DnaJ | 402..469 | CDD:278647 | 23/43 (53%) | ||
dnajb12b | NP_001082977.1 | DnaJ | 109..>151 | CDD:278647 | 22/41 (54%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |