DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl8 and F41C6.4

DIOPT Version :9

Sequence 1:NP_609795.2 Gene:Nepl8 / 34983 FlyBaseID:FBgn0032585 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001129930.1 Gene:F41C6.4 / 185599 WormBaseID:WBGene00018278 Length:393 Species:Caenorhabditis elegans


Alignment Length:98 Identity:22/98 - (22%)
Similarity:34/98 - (34%) Gaps:39/98 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VDKEANPCENYYNHAC--GQYNMRHIDDTFFDIIQMLDHQVNQNLVKLMDELEMSSQLPDFNVSS 90
            :|:.::||:::|.|||  |.|                |..|......:..|||.|.:        
 Worm    29 IDQSSDPCDDFYRHACPVGDY----------------DFLVLMKYAPIFKELETSQE-------- 69

  Fly    91 VDGKVLRYYLSCRGAPRNMDSLSQYLKVISPGE 123
                        ..|..|: .:.:.|..|.|||
 Worm    70 ------------ESAWENL-KIEEALNNIKPGE 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl8NP_609795.2 GluZincin 32..618 CDD:301352 21/94 (22%)
F41C6.4NP_001129930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.