powered by:
Protein Alignment Nepl8 and F41C6.4
DIOPT Version :9
Sequence 1: | NP_609795.2 |
Gene: | Nepl8 / 34983 |
FlyBaseID: | FBgn0032585 |
Length: | 619 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001129930.1 |
Gene: | F41C6.4 / 185599 |
WormBaseID: | WBGene00018278 |
Length: | 393 |
Species: | Caenorhabditis elegans |
Alignment Length: | 98 |
Identity: | 22/98 - (22%) |
Similarity: | 34/98 - (34%) |
Gaps: | 39/98 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 VDKEANPCENYYNHAC--GQYNMRHIDDTFFDIIQMLDHQVNQNLVKLMDELEMSSQLPDFNVSS 90
:|:.::||:::|.||| |.| |..|......:..|||.|.:
Worm 29 IDQSSDPCDDFYRHACPVGDY----------------DFLVLMKYAPIFKELETSQE-------- 69
Fly 91 VDGKVLRYYLSCRGAPRNMDSLSQYLKVISPGE 123
..|..|: .:.:.|..|.|||
Worm 70 ------------ESAWENL-KIEEALNNIKPGE 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nepl8 | NP_609795.2 |
GluZincin |
32..618 |
CDD:301352 |
21/94 (22%) |
F41C6.4 | NP_001129930.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11733 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.