DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl8 and nep-15

DIOPT Version :9

Sequence 1:NP_609795.2 Gene:Nepl8 / 34983 FlyBaseID:FBgn0032585 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001257056.2 Gene:nep-15 / 185513 WormBaseID:WBGene00018227 Length:267 Species:Caenorhabditis elegans


Alignment Length:171 Identity:45/171 - (26%)
Similarity:68/171 - (39%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 HHLISAFATEGITIGSDGNDQSFRSHR-------FEEAV------------------SCLSRNSE 526
            :|:.......|.::|.:.....|.:|.       |.|.|                  ||::|| |
 Worm    77 NHITLVLGFTGFSVGHEIGHSFFANHSGTDILPYFSENVEKCVQNQFNSTCNEYKEESCVTRN-E 140

  Fly   527 NIDESMGDIAGLELAYFTYAKMAKNR--NRLDFTHLPPEQIFFLNVGQFFCGNSDMLVQYKED-- 587
            .:|::..||.||:|||....|....|  .|::..::..||:||.:....||..|...|..:|:  
 Worm   141 MLDDNGADIFGLQLAYKLMEKYLSGRLEERIERLNVTQEQLFFYSFANQFCSGSLSKVFIEEEGD 205

  Fly   588 -------QVRLQRAIEGFEPFDKAFGCYRN----KPKHEKC 617
                   .||: .|:.....|.|||.|..|    |...|:|
 Worm   206 YDPHSVNNVRV-NAVAQHPGFRKAFNCPDNSRMMKSATEQC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl8NP_609795.2 GluZincin 32..618 CDD:301352 45/171 (26%)
nep-15NP_001257056.2 GluZincin <87..237 CDD:387391 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.