DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and AT4G19770

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:301 Identity:68/301 - (22%)
Similarity:119/301 - (39%) Gaps:58/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTE 186
            :.|...|.:.||.|...:.|.|.||||||..:.|||....  .|.....|.::....|       
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPRNAAEM--SDFAELLKEWRYAVQG------- 56

  Fly   187 SETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVN-SSWYYDAPSIAPSLDFINLGTFDFLTPQR 250
             |.:..::..||             |:.||..:.| :...|....|:..||::|:..:||..|..
plant    57 -EAYSSELPVLI-------------LTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGC 107

  Fly   251 NPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMP 315
            .......:|...::.|.:.      :..::.|:...:||.|..:|...||.:|.:: |..:.|..
plant   108 TEVTGPPAALYLQSDGPSG------DSGVKDWIDAGLPAEKAVLGFPYYGWAWTLA-DPKNHGYY 165

  Fly   316 VVPSTQGPAPAGPQSKQEGLLNWAEICS-LMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAAD 379
            |  .|.|||     ...:|.::::::.: ::.|.:.:            |......|.|.:... 
plant   166 V--DTTGPA-----ISDDGEISYSQLKTWIVDNKATT------------VHDNIVIGDYCYAGT- 210

  Fly   380 ENGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDD 420
                  .||.||..:|..:|.:||:.:.|.|...:.:..||
plant   211 ------TWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 68/301 (23%)
Glyco_18 27..419 CDD:214753 66/298 (22%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 68/301 (23%)
Glyco_18 <1..244 CDD:214753 66/298 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.