DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and AT4G19750

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:371 Identity:95/371 - (25%)
Similarity:157/371 - (42%) Gaps:92/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 THLVYGYAGVNADNYEMQSINKRLDLEQRHLAQITS----MKERYPHIKFLLSVGG-DADTYEGN 116
            |||...:|.|::..:|       :.:...:..|::|    :|::...::.|||:|| |||    .
plant    38 THLFCAFADVDSSTHE-------VTISAANSCQVSSFTHTVKDKNTDVQTLLSIGGKDAD----K 91

  Fly   117 QYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDF 181
            ..:..:.|..:..:.||:|:.|:.|:.:|.|||||.:.|.|       ||..|  :|.|      
plant    92 AVLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPSN-------DVEMA--NFGK------ 141

  Fly   182 IVDTESETHKGQVTALIKDLSAAL-----KQNDLLLSLTVLPNVNSSWY---YDAPSIAPSLDFI 238
                           |:|:..||:     :.|.|.|.||.....:..:|   |...:||.:|||:
plant   142 ---------------LVKEWRAAVVEESDRTNQLPLLLTAAVYYSPDYYGEEYPVQAIADNLDFV 191

  Fly   239 NLGTFDFL----TPQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATY 299
            |:..:||.    :|...|..|.|. |:..|   .|.|...|:    .||..::||.|..:|.:..
plant   192 NIMAYDFYGPGWSPVTGPPAALFD-PSNPA---GRSGDSGLS----KWLEAKLPAKKAVLGFSYC 248

  Fly   300 GRSWKMSKDSGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVV 364
            |.:|.: :|:.::|...  :|.|.|     ...:|.:.:|:|.:.:.:...:....|..      
plant   249 GWAWTL-EDAENNGYDA--ATDGAA-----ISSDGSITYAKIRNYIIDNGAATFHDPAV------ 299

  Fly   365 DPTKRYGSYAFRAADENGDHGLWISYDDPDSASSKAMYARARNLGG 410
                 .|.|.:...       .||.|||..|..||..||:.:.|.|
plant   300 -----IGFYCYVGT-------TWIGYDDNQSIVSKVRYAKLKGLLG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 95/371 (26%)
Glyco_18 27..419 CDD:214753 95/371 (26%)
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 95/371 (26%)
Glyco_18 14..342 CDD:214753 95/371 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.