DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and AT4G19740

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:196 Identity:54/196 - (27%)
Similarity:78/196 - (39%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVH-GDVGSAWKSFKKFFTGDFIVDT 185
            :.|.:.....||.|:..:.|...|.|||||.:.|.|.....: |.:...|:|         .|:.
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYPNNDVEMNNFGKLLQEWRS---------AVEV 56

  Fly   186 ESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVN-SSWYYDAPSIAPSLDFINLGTFDF--LT 247
            ||     |.|.:          ..|||:..|....: :|..|...:|..|||::||..::|  ||
plant    57 ES-----QRTGI----------RPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLT 106

  Fly   248 PQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKM--SKDSG 310
            .:..|     .|..|:...:...|...|    :|||...:|..|...|....|.||.:  .||.|
plant   107 TEIGP-----PAGLYDPSIKGPCGDTGL----KHWLKAGLPEKKAVFGFPYVGWSWTLDDDKDHG 162

  Fly   311 D 311
            |
plant   163 D 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 54/196 (28%)
Glyco_18 27..419 CDD:214753 54/196 (28%)
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 49/174 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.