DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and Ctbs

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_112285.1 Gene:Ctbs / 81652 RGDID:621338 Length:367 Species:Rattus norvegicus


Alignment Length:354 Identity:71/354 - (20%)
Similarity:110/354 - (31%) Gaps:122/354 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DVG-SAWKSF--KKFFT----GDFIVDTESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVNS 222
            ||| ..|||:  .:..|    |.:..:.....|......::|        .|:.|...:.|...:
  Rat    49 DVGQKTWKSYDWSQITTVAVFGKYDSELMCYAHSKGARVVLK--------GDVALKDIINPTFRA 105

  Fly   223 SWYYDAPSIAPS--LDFINLGTFDFLTPQRNPEEADFSAPTYEA----VGQNRLGH--------- 272
            ||.....::|.:  :|.||:..         .:|.|.|:|.|||    |.:...|.         
  Rat   106 SWIAQKVALAKAQHMDGINIDI---------EQEVDCSSPEYEALTALVRETTEGFHREIEGSQV 161

  Fly   273 ---------------YNLN---------FQMEH---------------------------WLLQR 286
                           ||..         |.|.:                           :|...
  Rat   162 TFDVAWSPKGIDKRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYGDYLRMG 226

  Fly   287 VPANKINIGIATYGRSW---KMSKDSGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNP 348
            :...|:.:||..||..:   .:|||.      |....:.|....|.|...|......:.....|.
  Rat   227 ISPRKLVMGIPWYGYDYICLNLSKDD------VCAIAKVPFRGAPCSDAAGHQVPYRVIMKQVNS 285

  Fly   349 SNSNA---RGPNAPVKRVVDPTKRYGSYAFRAADENGDHGLWISYDDPDSASSKAMYARARNLGG 410
            |.|.:   :...||.....|||.|.             |.:|  ||:|.|.|.||.:.:...|.|
  Rat   286 SVSGSQWNQDQQAPYYNYKDPTGRL-------------HQVW--YDNPRSISLKAAFVKHYGLRG 335

  Fly   411 VALF-----DLTQDDFRGQCTNDRFPMLR 434
            :.::     |.:.|....:.|.:.:..||
  Rat   336 IGMWNANCLDYSDDALAREQTEEMWGALR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 71/354 (20%)
Glyco_18 27..419 CDD:214753 67/337 (20%)
CtbsNP_112285.1 GH18_chitobiase 23..363 CDD:119354 69/351 (20%)
Glyco_18 <100..343 CDD:214753 54/272 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.