DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and ctbs

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001011500.1 Gene:ctbs / 497004 XenbaseID:XB-GENE-975891 Length:369 Species:Xenopus tropicalis


Alignment Length:281 Identity:61/281 - (21%)
Similarity:110/281 - (39%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KKFFTGDFIVDTESETHKGQ-----VTALIKDLSAALKQ----NDLLLSLTVLPNVNSSWYYDAP 229
            |..|.....:|.|....||.     :|||:::.:.|..:    :.:...:...|:......|:..
 Frog   117 KSQFMDGINLDIEQSVLKGSPEYYALTALVEETTEAFHREIPGSQVTFDVAWSPDCVDERCYNYT 181

  Fly   230 SIAPSLDFINLGTFDFLTPQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINI 294
            .||.|.||:.:.::|..:.......|..::|.     ...|..|....|::      :...|:.:
 Frog   182 GIAESCDFLFVMSYDEQSQIWTECVASANSPL-----NKTLSGYQKFTQLD------IDPKKLVM 235

  Fly   295 GIATYGRSWK-MSKDSGDSGMPVVPSTQGPA--PAGPQSKQEGLLNWAEICSLMPNPSNSNARGP 356
            |:..||..:. :..:..:..:..||....|.  .||.|      :.:::|...:    ||:..| 
 Frog   236 GVPWYGYDYPCLDLEDNNCTLKEVPFRGAPCSDAAGKQ------IPYSKITKQV----NSSLTG- 289

  Fly   357 NAPVKRVVDPTKRYGSYAFRAADENGD-HGLWISYDDPDSASSKAMYARARNLGGVA-----LFD 415
                 |:.|..::...|.::  |..|. |.:|  ||||.|.|.|:.|.:...|.|:.     |.|
 Frog   290 -----RLWDDVQKSPFYNYK--DAKGQFHQVW--YDDPVSISLKSAYIKKLGLRGIGMWNGDLLD 345

  Fly   416 LTQDDFRGQCTNDRFPMLRAI 436
            .:||......|.|.:..|:.:
 Frog   346 YSQDPIAETQTKDMWNALKGV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 61/281 (22%)
Glyco_18 27..419 CDD:214753 56/262 (21%)
ctbsNP_001011500.1 GH18_chitobiase 9..363 CDD:119354 60/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.