DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and Cht7

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster


Alignment Length:419 Identity:108/419 - (25%)
Similarity:194/419 - (46%) Gaps:68/419 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHLAQITSM 93
            |:..|..::|.|..:|...:|:..|  |||:||.:|  ...:|:   :.:..|.:..:...:.::
  Fly   562 CYLTSWSAKRPGAGKFQPENIDPKL--CTHIVYAFA--TLQDYK---LTEATDDDPENYESVIAL 619

  Fly    94 KERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNK 158
            ::..|.::.||::||.|   .|:...|.|.|......:|:..|.|.:|.|.|:|||:..:.||..
  Fly   620 RDNNPDLQILLAIGGWA---FGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYPRGA 681

  Fly   159 PRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVNSS 223
            ..:|      |:.|..|    :..|..|.|.....:..|:  |:||:..:...::..        
  Fly   682 EDRV------AYVSLLK----ELRVAFEGEAKSSGLPRLL--LTAAVPASFEAIAAG-------- 726

  Fly   224 WYYDAPSIAPSLDFINLGTFDF------LTPQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHW 282
              ||.|.|:..|||||:.|:||      .....:|..|..||..|    |.:|   .:::....|
  Fly   727 --YDVPEISKYLDFINVMTYDFHGQWERTVGHNSPLFALESATGY----QKKL---TVDYSAREW 782

  Fly   283 LLQRVPANKINIGIATYGRSWKMSKDSG-DSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMP 346
            :.|..|..|:.||:.|||||:::..|:. |.|.|    :.|...||..:.:.|.|::.|:||.:.
  Fly   783 VKQGAPKEKLLIGMPTYGRSFELVNDTQFDIGSP----SSGGGKAGKFTNEAGFLSYYEVCSFLA 843

  Fly   347 NPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADENGDHGLWISYDDPDSASSKAMYARARNLGGV 411
            ..:.:           :|..:::...:|:|.       ..|:.:||..|..:|..:.:.:..||:
  Fly   844 ADNTT-----------LVWDSEQQVPFAYRG-------NQWVGFDDERSLKTKTEWLKEQGFGGI 890

  Fly   412 ALFDLTQDDFRGQCTNDRFPMLRAIKYRL 440
            .::.:..|||.|:|.:.::|:|.|:...|
  Fly   891 MVWSIDMDDFSGRCGSGKYPLLTALNDEL 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 107/417 (26%)
Glyco_18 27..419 CDD:214753 99/396 (25%)
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 99/396 (25%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 107/417 (26%)
CBM_14 951..1005 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463844
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.