DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and Cht2

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster


Alignment Length:472 Identity:108/472 - (22%)
Similarity:202/472 - (42%) Gaps:111/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SLWLSLALSLAVLAQFKVSAAPNLVCFYDSQGSQR--QGLAQFSMIDIELALQFCTHLVYGYAGV 66
            |||.|:|.....|.. ||     :||:..:....|  ||.......|..|    |||:||.:||:
  Fly    26 SLWASVAARTGPLHD-KV-----VVCYVSTWAVYRPEQGAYAIENFDPNL----CTHVVYAFAGL 80

  Fly    67 NADNYEMQSINKRLDLEQRH----LAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQ 127
            :.....::|::...||::.:    ..::|.:|..:||:|..|::||   ..||:.....|.:...
  Fly    81 DITQAAIKSLDPWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGG---WNEGSANYSTLVANNL 142

  Fly   128 GHRRFIESARDLVRRYNFDGLDLALQLP---RNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESET 189
            ...||::.....:|:||||||||..:.|   :.||                       .|.|:  
  Fly   143 LRGRFVKQVSSFIRKYNFDGLDLDWEYPTQRKGKP-----------------------ADREN-- 182

  Fly   190 HKGQVTALIKDLSAALKQNDLLLSLTVLPN---VNSSWYYDAPSIAPSLDFINLGTFDF--LTPQ 249
                ...|.|:|.....::.|||:..:..:   ::.:  ||...|:..||::::..:|:  ...:
  Fly   183 ----FVLLTKELREEFDEHGLLLTSAIGASKKVIDEA--YDVRQISRYLDYLHIMCYDYHGSWDR 241

  Fly   250 RNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGM 314
            |....|..:||..:.:        ::.|.:::.|....|..|:.:|:..|||::|...    ||.
  Fly   242 RVGYNAPLTAPADDPL--------SVKFSIDYLLKLGAPPEKLVMGLPFYGRTFKTLA----SGF 294

  Fly   315 PVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAAD 379
             :...::|....||.::::|.|.:.|||..:.|.::...|..:....:|:..::|          
  Fly   295 -LNDVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWDPQTSQVLAKSER---------- 348

  Fly   380 ENGDHGLW------ISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQC------------- 425
                 .::      ::||...|.::|.::|.::.|.||.::.:..|||.|.|             
  Fly   349 -----NVFTQEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNCKLDEDTYEDFQKV 408

  Fly   426 ------TNDRFPMLRAI 436
                  ::..:|:||.|
  Fly   409 TAAPKRSSQNYPLLRTI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 100/450 (22%)
Glyco_18 27..419 CDD:214753 91/411 (22%)
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 92/417 (22%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 100/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.