DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and Cht9

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster


Alignment Length:441 Identity:131/441 - (29%)
Similarity:204/441 - (46%) Gaps:88/441 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALSLAVLAQFKVSAAPNLV-CFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNYE 72
            ||| ||||...:|..|..:| |::.:..:.|.|..:|.:.:|:..|  ||||.|.:.|:| ||.|
  Fly     5 LAL-LAVLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGL--CTHLSYSFFGIN-DNGE 65

  Fly    73 MQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESAR 137
            :||::..||.:...:.|..|:|.:..::|.|..|||   ..||:.....:.......:.||.||.
  Fly    66 IQSLDTWLDYDLGFINQAISLKNQNSNLKVLAVVGG---WNEGSTKYSSMSGDWYKRQNFINSAL 127

  Fly   138 DLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLS 202
            :|:|.:.||||||..:.|..:        |..|.....|.|                  |::::.
  Fly   128 NLLRNHGFDGLDLDWEYPNQR--------GGNWNDRANFVT------------------LLREIK 166

  Fly   203 AALKQNDLLLSLTVLPNVN-SSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEEADFSAPTYEAVG 266
            .|.......|.:.|....: :|..|:..:||..:||||:.|:||  ...:..:..|:||.:..  
  Fly   167 EAFAPYGYELGIAVGAGESLASASYEIANIAQQVDFINVMTYDF--AMASDGQTGFNAPQWAV-- 227

  Fly   267 QNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMPVVPSTQGPAPAGPQSK 331
            :|.     :||    ||.|..||||:.:|:.|||||:::|..|  ...|..| .:|...||..:.
  Fly   228 ENA-----INF----WLSQGAPANKLVLGVGTYGRSFQLSDSS--QNWPGAP-CRGEGSAGSYTG 280

  Fly   332 QEGLLNWAEICSLMPNPSN-------SNARGPNAPVKRVVDPTKRYGSYAFRAADENGDHGLWIS 389
            ..|.|.:.|||.     :|       .||    ||             ||:     :||.  |:|
  Fly   281 STGYLGYNEICQ-----NNWHTVFDYDNA----AP-------------YAY-----SGDQ--WVS 316

  Fly   390 YDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQCTNDRFPMLRAIKYRL 440
            :|:..|...|..:|.::.|.|..::.|..||:|||| .:.:|:|:.|..:|
  Fly   317 FDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQC-GETYPLLKTINRKL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 121/422 (29%)
Glyco_18 27..419 CDD:214753 112/400 (28%)
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 121/420 (29%)
Glyco_18 23..346 CDD:214753 112/399 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.