DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and btb-18

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_872066.2 Gene:btb-18 / 353391 WormBaseID:WBGene00018201 Length:298 Species:Caenorhabditis elegans


Alignment Length:121 Identity:20/121 - (16%)
Similarity:46/121 - (38%) Gaps:34/121 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLAVLAQFKVSAAPNLVCFYDSQGSQR--QGLAQFSMIDIELALQFCTHLVYGYAG--------- 65
            ::.|:.:.|:....:.:|::.....:.  ..|.:.:.::|||     ..:||...|         
 Worm   142 AVLVIGERKLHVNKDFLCYHSDHFRELFFSNLKKDASVEIEL-----RDVVYEDFGHLMSTIHPN 201

  Fly    66 -------------VNADNYEMQSINKRLDLEQRHLAQITS-----MKERYPHIKFL 103
                         |.||.:::||....::....|.:::.:     |.::|...|.|
 Worm   202 PVFPNDRSVEKILVLADRFKVQSAIDHVEHHLLHNSRLANECMMWMADKYGMKKLL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 18/107 (17%)
Glyco_18 27..419 CDD:214753 18/106 (17%)
btb-18NP_872066.2 BTB 141..237 CDD:197585 16/99 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.