DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chia.4

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_956740.1 Gene:chia.4 / 337333 ZFINID:ZDB-GENE-030131-9279 Length:475 Species:Danio rerio


Alignment Length:456 Identity:123/456 - (26%)
Similarity:202/456 - (44%) Gaps:101/456 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGSLWLSLALSLAVLAQFKVSAAPNLVCFYDSQGSQRQGLAQF--SMIDIELALQFCTHLVYGY 63
            |||.::|: .:|||:.   :...|..|.|::.:....|..:.::  |.:|..|    ||||:|.:
Zfish     1 MTGLIFLA-GISLALC---QCGLASQLACYFANWSQYRPDVGKYMPSNVDPHL----CTHLIYAF 57

  Fly    64 AGVNADNYEMQSINKRLDLEQRHLAQ-ITSMKERYPHIKFLLSVGGDADTYE-GNQYIKLLESGQ 126
            :.:|..|....|     :.....|.| ..::|:..|::|.||:||    |.. |:.....:.|..
Zfish    58 SVINIKNKLATS-----EWNDETLYQSFNALKQSNPNLKTLLAVG----TLNLGSTQFSRMVSTP 113

  Fly   127 QGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETH- 190
            |..:.||||:...:|.:.||||||..:.|           ||.                ||... 
Zfish   114 QKRQTFIESSIKFLRTHGFDGLDLDWEYP-----------GSG----------------ESPPED 151

  Fly   191 KGQVTALIKDL-------SAALKQNDLLLSLTVLPN---VNSSWYYDAPSIAPSLDFINLGTFDF 245
            |.:.|.|.|:|       |.|.::..|:|:..|...   :::.  |:...::..|||||:.|:||
Zfish   152 KHRFTLLCKELLKAYQAESKATRRPRLMLTAAVAARKGIIDAG--YEIAEVSKYLDFINIMTYDF 214

  Fly   246 ------LTPQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWK 304
                  :|...:|...| |..|.:.:      :||.:|.|.:|..|..|..|:.:|.|.|||::.
Zfish   215 HGSWENVTGHNSPLYRD-SRDTGDQI------YYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFC 272

  Fly   305 MSKDSGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKR 369
            :|......|.||    .|||.||..:::.|..::.|||:.:          ..|.|:::.|....
Zfish   273 LSSAVNGLGAPV----SGPASAGTYTREAGYWSYYEICTFL----------QRASVEQIADQKVP 323

  Fly   370 YGSYAFRAADENGDHGL-WISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQ-CTNDRFPM 432
            |.:           .|| |:.:||..|..:|..|.:.:..||..::.|..|||.|| |...::|:
Zfish   324 YAT-----------EGLNWVGFDDQKSYETKVDYLKEKGFGGAFVWSLDLDDFSGQFCGQGKYPL 377

  Fly   433 L 433
            :
Zfish   378 I 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 115/431 (27%)
Glyco_18 27..419 CDD:214753 108/413 (26%)
chia.4NP_956740.1 Glyco_18 22..363 CDD:214753 108/414 (26%)
GH18_chitolectin_chitotriosidase 25..381 CDD:119351 114/428 (27%)
ChtBD2 425..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.