DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chia.6

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 / 322420 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio


Alignment Length:448 Identity:119/448 - (26%)
Similarity:195/448 - (43%) Gaps:103/448 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAQFKVSAAPNLVCFYDSQGSQRQGLAQF--SMIDIELALQFCTHLVYGYAGVNADN----YE-- 72
            ||......|..|||::.:....|..:.::  |.:|..|    ||||:|.::.:|.:|    ||  
Zfish    12 LALCHFGLASQLVCYFTNWSQYRPDVGKYMPSNVDPHL----CTHLIYAFSIINNENKLTTYEWN 72

  Fly    73 ----MQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFI 133
                .||.|              .:|:..|::|.||:|||   ...|......:.|..|..:.||
Zfish    73 DETLYQSFN--------------GLKQSNPNLKTLLAVGG---WNFGTTQFSSMVSTPQNRQTFI 120

  Fly   134 ESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALI 198
            :|:...:|.:.||||||..:.|        |..||..:..::|                  |.|.
Zfish   121 QSSITFLRTHGFDGLDLDWEYP--------GSRGSPPEDKQRF------------------TLLC 159

  Fly   199 KDL-------SAALKQNDLLLSLTVLP---NVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPE 253
            |:|       |||..:..|:|:..|..   |:::.  |:...||..|||||:.|:||.....:  
Zfish   160 KELVEAYQAESAATGRPRLMLTAAVAAGKGNIDAG--YEIAEIAKYLDFINIMTYDFHGSWES-- 220

  Fly   254 EADFSAPTYEAVGQNRLG---HYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMP 315
            ....::|.|.  |...:|   :||.:|.|.:|..|..|..|:.:|.|.|||::::|......|.|
Zfish   221 VTGHNSPLYR--GSGDIGDKIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFRLSSAVSGVGAP 283

  Fly   316 VVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADE 380
                ..|.|.||..:::.|..::.|||:.:          ..|.|:::||....|.:        
Zfish   284 ----ASGAASAGTYTREAGFWSYYEICTFL----------KQATVQQIVDQKVPYAT-------- 326

  Fly   381 NGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQ-CTNDRFPMLRAIK 437
            .|..  |:.:|:.:|..:|..|.:.:..||..::.|..|||.|| |...::|::..::
Zfish   327 KGQE--WVGFDNMESYKTKVDYLKEKGFGGAFVWALDLDDFSGQFCGQSKYPLIGQLR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 116/438 (26%)
Glyco_18 27..419 CDD:214753 109/416 (26%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 109/417 (26%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 116/437 (27%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.