DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and Cht11

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:468 Identity:109/468 - (23%)
Similarity:183/468 - (39%) Gaps:113/468 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLSLALSLAVLAQFKV-------------SAAPNLVCFYDSQGSQRQGLAQFSMIDIELALQFCT 57
            |.:|..||..|....:             .....|||:|.|.|:.     ..|::|:...|  ||
  Fly    35 WSALLFSLLCLCLGFIGLGLLGIQTGEVHKVGQRLVCYYASDGTH-----NLSLLDVPGDL--CT 92

  Fly    58 HLVYGYAGV-NADNYEMQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKL 121
            |:..|.|.: ||......::.:.|..:.|      |.:..:|.:..||.:|| ||:  |..: .|
  Fly    93 HINIGPATLDNATIVLPDTLRQVLQNDTR------SFRAAHPQVHLLLWIGG-ADS--GRSF-AL 147

  Fly   122 LESGQQGHRRFIESARDLVRRY-NFDGLDLALQLPRNKPR-KVH-----GDVGSAWKSFKKFFTG 179
            :.:.....:.|:.|.|:::|.| :.||:||..:.|....| ::|     .::.:.|:..|     
  Fly   148 MVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREK----- 207

  Fly   180 DFIVDTESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVNSSWYYDAPSIAPSLDFINLGTFD 244
                                      :.||:|......|...:.:.||...|....|::||.::|
  Fly   208 --------------------------RTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYD 246

  Fly   245 FLTPQRNPEEADFSAPTYEAVGQNR--LGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSK 307
            |...:.:......:||.| |..|.|  :..:|:|:.::.||...:...::.:|:.|||.|:.:..
  Fly   247 FHFYREDTPFTGLNAPLY-ARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVN 310

  Fly   308 DSGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGS 372
                   |:......||....:..|.|.....|.|..               |.:...|...|.:
  Fly   311 -------PLNHRIGAPASGYGKCGQLGFTTLTETCEC---------------VTKFFKPNLSYDA 353

  Fly   373 YA----FRAADENGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQCT------- 426
            .:    ..|..|      ||||::..|.:.||.|.::.|||||.:|.|..||.:..|:       
  Fly   354 ESCSPYLSALQE------WISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNSCSIMPNLKY 412

  Fly   427 --NDRFPMLRAIK 437
              ...||:.:|||
  Fly   413 SEKPVFPLTQAIK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 104/435 (24%)
Glyco_18 27..419 CDD:214753 96/405 (24%)
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 96/406 (24%)
GH18_chitinase-like 69..428 CDD:299167 104/434 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.