DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and Chi3l3

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_008759605.2 Gene:Chi3l3 / 295351 RGDID:1308790 Length:401 Species:Rattus norvegicus


Alignment Length:456 Identity:115/456 - (25%)
Similarity:195/456 - (42%) Gaps:94/456 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLALSLAVLAQFKVSAAPNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNY 71
            |.||..||:|....:.::..|:|:|.|....|..:..|.:.:|:..|  ||||:|.:||:..:..
  Rat     4 LILATGLAILLYAHLGSSYQLMCYYTSWAKDRPTVGSFKIGNIDPCL--CTHLIYAFAGMRNNEI 66

  Fly    72 EMQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESA 136
            ...|....:|.|     .|..:|:|...:|.||::||   ...|:.....:.|..|..:.||:|.
  Rat    67 INTSEQDLIDYE-----AINYLKDRNTELKTLLAIGG---WKFGSAPFSAMVSTPQNRQTFIKSV 123

  Fly   137 RDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDL 201
            ...:|:|.||||:|..|.|        |..||..|. |..|                 :.|::::
  Rat   124 IKFLRQYKFDGLNLDWQYP--------GSRGSPPKD-KHLF-----------------SVLVQEM 162

  Fly   202 SAALKQND-------LLLSLT---VLPNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEEAD 256
            ..|.::..       |||:.|   |:..:.|.  |..|.::.|||:..:.|::.         .|
  Rat   163 RKAFEKESTEQEIPRLLLTATVAGVIDTIQSG--YKIPELSQSLDYFQVMTYNL---------HD 216

  Fly   257 F-------SAPTYEAVGQNRLGHY-NLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSG 313
            |       ::|.|::.....:..| |::..:.:|........|:.:|...||.::.:| |..::|
  Rat   217 FQNGYTRENSPLYQSPSDTGIYAYLNVDAIISYWKDNGAAREKLIVGFPAYGHNFILS-DPSNTG 280

  Fly   314 M--PVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGP-NAPVKRVVDPTKRYGSYAF 375
            :  |:|.:    .|.|..:.:.||..:.|||:.:.:.:.....|| ..|             ||.
  Rat   281 INAPIVST----GPPGKFTGEAGLWAYYEICTFLNDGATDLWDGPQEVP-------------YAV 328

  Fly   376 RAADENGDHGLWISYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQ-CTNDRFPMLRAIKYR 439
            :.       .:|:.||:..|...||.:.:...|||..::.|..|||.|. |...|||:...:|:.
  Rat   329 QG-------NVWVGYDNVKSFKIKAQWLKDNKLGGAMVWPLDMDDFTGSFCQQGRFPLTSTLKHY 386

  Fly   440 L 440
            |
  Rat   387 L 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 108/435 (25%)
Glyco_18 27..419 CDD:214753 99/412 (24%)
Chi3l3XP_008759605.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 108/434 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.