DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chil-9

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001366720.1 Gene:chil-9 / 191470 WormBaseID:WBGene00014162 Length:460 Species:Caenorhabditis elegans


Alignment Length:414 Identity:87/414 - (21%)
Similarity:158/414 - (38%) Gaps:113/414 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LQFCTHLVYGYA--GVNADNYEMQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEG 115
            |:..||:|:.:|  ......:..:|.:::.:..:|::.:.:|.      :|.::|:||.   |..
 Worm   131 LRMLTHIVFLFAFPKNGTITFGGESSSQKFEEMRRNVRKASST------LKVMISIGGQ---YNS 186

  Fly   116 NQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGD 180
            .::..|: |.:.....|:.|....||.|:.||:|:....|:      |.|..:.....::.    
 Worm   187 GEFSGLV-SNETSRNLFVNSIATFVRDYDIDGVDIFWTWPK------HSDENNYLMFIREL---- 240

  Fly   181 FIVDTESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVNSSWYYDAPSIAPSLDFINLGTFDF 245
                      :...|.|.|.|:   ::...::||.:..|||.  .......:..:||||:.:|:.
 Worm   241 ----------RYAFTELQKKLN---RKETFVISLVISRNVNH--LSKLVEFSNFVDFINIYSFNS 290

  Fly   246 LTPQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRSWK-----M 305
            ...|..|:     :|.|..      |..|::..|::::.:....:|.||.::.:...|:     :
 Worm   291 YLYQVGPD-----SPLYGG------GSRNVDEIMKYYICKTGQPSKFNIIVSFHATYWEGAELPL 344

  Fly   306 SKDSGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRY 370
            ..||.|     :...|..|..|      ..:.|.|:  |......||.:..|.        ||. 
 Worm   345 RDDSDD-----IFKDQNSAKGG------FAVRWREL--LQQKWDMSNIKFHNL--------TKT- 387

  Fly   371 GSYAFRAADENGDHGLWI--------SYDDPDSASSKAMYARARNLGGVALFDLTQDDFRGQ--- 424
             ||            :||        :.:|..|...|..|....|:||:.::.:.|||  |.   
 Worm   388 -SY------------MWIPGPPTRFMTLEDEKSLREKNRYVADHNIGGITMWTIDQDD--GDHTL 437

  Fly   425 ---------CTNDRFPMLRAIKYR 439
                     ||.||   ...|||:
 Worm   438 LKVVSSAELCTGDR---RNEIKYK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 87/414 (21%)
Glyco_18 27..419 CDD:214753 76/380 (20%)
chil-9NP_001366720.1 Glyco_18 113..431 CDD:214753 76/380 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.