DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chil-27

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:202 Identity:48/202 - (23%)
Similarity:85/202 - (42%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHLAQ 89
            |.:....||.||::..       |....:.|....: |:.|....::..::.:|   |:::  ::
 Worm    83 PTVPLLTDSSGSEKPP-------DKVTFVLFAADRI-GFDGSVEVDHSSRTFSK---LKEK--SK 134

  Fly    90 ITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQL 154
            |.|     .|.|.|||:||.::|    |::.|:.:..:..|||.:|...::..|..||:||    
 Worm   135 IES-----SHFKKLLSIGGRSNT----QFLPLVIADPRRKRRFFKSIISILEEYQLDGVDL---- 186

  Fly   155 PRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALKQ--NDLLLSLTVL 217
                          .||..|           .|.|.|  .:..:.:|...||:  .:.:||:.:|
 Worm   187 --------------LWKWAK-----------NSNTKK--CSRFLCELKQKLKERKKNYVLSVQIL 224

  Fly   218 PNVNSSW 224
            |:..|||
 Worm   225 PDEPSSW 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 47/201 (23%)
Glyco_18 27..419 CDD:214753 47/200 (24%)
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 44/191 (23%)
GH18_chitinase-like 97..>235 CDD:299167 43/188 (23%)
Glyco_hydro_18 261..>402 CDD:279094
GH18_chitinase-like 268..>407 CDD:299167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.