Sequence 1: | NP_001285982.1 | Gene: | Idgf3 / 34981 | FlyBaseID: | FBgn0020414 | Length: | 441 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496035.1 | Gene: | chil-27 / 188616 | WormBaseID: | WBGene00011848 | Length: | 407 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 48/202 - (23%) |
---|---|---|---|
Similarity: | 85/202 - (42%) | Gaps: | 55/202 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 PNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHLAQ 89
Fly 90 ITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQL 154
Fly 155 PRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALKQ--NDLLLSLTVL 217
Fly 218 PNVNSSW 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Idgf3 | NP_001285982.1 | GH18_IDGF | 26..440 | CDD:119352 | 47/201 (23%) |
Glyco_18 | 27..419 | CDD:214753 | 47/200 (24%) | ||
chil-27 | NP_496035.1 | Glyco_hydro_18 | 89..>228 | CDD:279094 | 44/191 (23%) |
GH18_chitinase-like | 97..>235 | CDD:299167 | 43/188 (23%) | ||
Glyco_hydro_18 | 261..>402 | CDD:279094 | |||
GH18_chitinase-like | 268..>407 | CDD:299167 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |