DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chil-16

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_496020.1 Gene:chil-16 / 187732 WormBaseID:WBGene00011158 Length:440 Species:Caenorhabditis elegans


Alignment Length:416 Identity:83/416 - (19%)
Similarity:157/416 - (37%) Gaps:112/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNAD---NYEMQSINKRLDLEQRHLA 88
            :|.:|...|:....:.|.:.:         ||.|:.:..::.|   ::|.:.. |...|..|.||
 Worm    88 IVGYYYRNGNDSIMMGQLAKL---------THAVFAFLELHPDGTIHFESRKA-KESFLYLRKLA 142

  Fly    89 QITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQ 153
            .|...     ..|.:.|:||.|:|    |:...:...::..|:||:|....:::|..||:||..:
 Worm   143 SILKF-----DAKIMFSIGGPANT----QFFSPIIQNEEMKRKFIDSIIYFLKQYKLDGVDLFWK 198

  Fly   154 LPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALK--QNDLLLSLTV 216
                            |.|     :||          |...::.:::|...|:  :.:.::|:.:
 Worm   199 ----------------WSS-----SGD----------KFTYSSFLQELKHKLRSHRQNYIISIVL 232

  Fly   217 LPNVNSSWY--YDAPSIAPSLDFINLGTFDFLTPQRN-------PEEADFSAPTYEAVGQNRLGH 272
            .|....:|.  ||...|...:||:|:.:.|:..|..|       |     |||....:|..:  :
 Worm   233 PPAGVDTWELGYDLEEIMEHVDFMNVYSMDYSGPWDNQWGTPTGP-----SAPLAFNIGPRK--N 290

  Fly   273 YNLNFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMPVVPSTQGPAPAGPQSKQEGLLN 337
            :|:::.|:::..:.....|.|:.|..|.|.|...:::.|      |.|:                
 Worm   291 FNVDWTMKYYSCKTQQPGKFNMVIPFYARYWNNVQEAVD------PRTE---------------- 333

  Fly   338 WAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADE--------NGDHGLWISYDDPD 394
                  :..|....|.|....|..     .:....|...:.|.        ..|...:.::::..
 Worm   334 ------VFRNAEIRNNRADGVPYM-----DRSSADYKMASWDNLTSTPYIWKPDERRFFTFENQK 387

  Fly   395 SASSKAMYARARNLGGVALFDLTQDD 420
            |.:.|..||...|||||.::.:...|
 Worm   388 SIAIKTRYAIDMNLGGVWIWSVDMGD 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 83/416 (20%)
Glyco_18 27..419 CDD:214753 82/413 (20%)
chil-16NP_496020.1 Glyco_18 87..411 CDD:214753 82/412 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.