DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and chil-12

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_506770.2 Gene:chil-12 / 187357 WormBaseID:WBGene00010799 Length:450 Species:Caenorhabditis elegans


Alignment Length:411 Identity:79/411 - (19%)
Similarity:154/411 - (37%) Gaps:91/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SAAPNLVCFYDSQGSQRQGLAQFSMIDIELALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRH 86
            :.:..::.:|.........:.|.|.:         ||.::.:..:..|. .:...||...:..|:
 Worm    90 TCSKRIIGYYSGTSDSEITINQVSKL---------THAIFAFVQLTFDG-TLVFRNKNRFMALRN 144

  Fly    87 LAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLA 151
            :|     |.....:||:.|:||...:...:..::    .|:..||||:|....:..:..||:|: 
 Worm   145 IA-----KTENSTVKFMFSIGGPGHSQNFSPVVR----NQEKKRRFIKSIFSFLEEHKLDGVDI- 199

  Fly   152 LQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTESETHKGQVTALIKDLSAALK-QNDLLLSLT 215
                                    |:....:.|      |...:..:.:|:..|| :.|.:||:.
 Worm   200 ------------------------FWKWPHLAD------KHAYSQFLLELNEILKTRKDYILSIL 234

  Fly   216 VLP-NVNSSWYYDAPSIAPSLDFINLGTFDFLTPQR----NPEEADFSAPTYEAVGQNRLGHYNL 275
            |.| .:..:..:....|..::||||:...|:..|..    ||...  .:|.|.  |..|...:|:
 Worm   235 VPPQGIGFASGFKMNEIVENVDFINIFAMDYYGPWASGWGNPTGP--ISPIYG--GSERREQWNV 295

  Fly   276 NFQMEHWLLQRVPANKINIGIATYGRSWKMSKDSGDSGMPVVPSTQGPAPAGPQSKQEGLLNWAE 340
            :.....:..:.:.::|.||.|..:.|.|      .:.|.|:      ..|.....:...|::...
 Worm   296 DNTAAIYSCETMRSSKFNIVIPFFARLW------NNVGKPI------DFPGKEVYRNVTLIDGKA 348

  Fly   341 ICSL-MPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADE-----NGDHGLWISYDDPDSASSK 399
            :..: ||..| :..:|.|            ..||.:....|     |.....:::::...|.::|
 Worm   349 VGEVYMPRRS-ALQKGYN------------LSSYNYDDLSETAFIYNSTTKEYLTFEVKRSIAAK 400

  Fly   400 AMYARARNLGGVALFDLTQDD 420
            ..|.:..|||||.::.:..||
 Worm   401 LDYVQNMNLGGVWIWQMDMDD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 79/407 (19%)
Glyco_18 27..419 CDD:214753 77/403 (19%)
chil-12NP_506770.2 Glyco_18 94..420 CDD:214753 77/404 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.