DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf3 and K08F9.3

DIOPT Version :9

Sequence 1:NP_001285982.1 Gene:Idgf3 / 34981 FlyBaseID:FBgn0020414 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:194 Identity:41/194 - (21%)
Similarity:72/194 - (37%) Gaps:64/194 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 THLVYGYAGVNADNYEMQSINKRLDLEQRHLAQITSMKERYPHIKFLLSVGGDADTYEGNQYIKL 121
            ||.|:....|| :|...::.:|    ||..|.....:.|.....|.::::|.:    :|:..|..
 Worm   145 THAVFTSEFVN-ENGSFENSHK----EQEFLECRKKLGESNSTAKIMIAMGFN----KGSCKIDC 200

  Fly   122 LESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTE 186
            :.|       |||       :|..||::|            |      |...:.|.       ::
 Worm   201 ITS-------FIE-------KYQVDGVEL------------H------WNHNEHFL-------SQ 226

  Fly   187 SETHKGQVTALIKDLSAALKQ--NDLLLSLTVLPNVNSSW--YYDAPSIAPSLDFINLGTFDFL 246
            .||        .::|...||:  |..||.:    :.:|:|  ..:...:....||:|:...|.|
 Worm   227 LET--------TRNLKNRLKKISNSKLLGV----SASSNWSRVTELDQVLEVADFVNIELHDNL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf3NP_001285982.1 GH18_IDGF 26..440 CDD:119352 41/194 (21%)
Glyco_18 27..419 CDD:214753 41/194 (21%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 38/186 (20%)
GH18_chitinase-like 124..276 CDD:299167 39/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.